KEGG   Corynebacterium diphtheriae HC01: CDHC01_1898Help
Entry
CDHC01_1898       CDS       T01693                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cdt  Corynebacterium diphtheriae HC01
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cdt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2006027..2006599)
Genome map
AA seq 190 aa AA seqDB search
MTAQFDQQRAEAAVRELLIAVGEDPDREGLQETPARVAKAYAEMFAGLHTDPTEVLAKTF
SEDHREVVLVRDIPIYSTCEHHLVPFFGKAHIGYIPGESGKVTGLSKLARLVDLYAKRPQ
VQERLTTQVADALVDKLQAQAVIVVIECEHLCMAMRGIRKPGAVTTTSAVRGGFKTNAAS
RAEVLSLIRG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacaatttgatcaacaacgcgccgaagccgcagtccgagaactcctcatcgcc
gtcggtgaagatcccgaccgcgaaggactgcaagaaacaccagcgcgcgtagccaaggcc
tacgccgaaatgttcgcaggcctgcacaccgaccccaccgaggtcctcgctaaaaccttc
agcgaggaccatcgggaagtagtcctagtccgcgacatcccgatctactccacctgcgaa
caccacctcgtgcccttcttcggcaaagcacacatcggctacatcccaggcgaatccgga
aaagtcaccggcctatccaaactcgcacgactcgttgacctctacgccaaacgcccccag
gtccaagaacgcctgaccacccaagtggcagacgcactggtagacaagctacaagcccaa
gcagtcatcgtggtcatcgaatgcgaacacctctgcatggccatgcgcggtatccgcaaa
ccaggagccgtgactaccacgtctgcagttcgtggcggatttaaaaccaacgcagcctcc
cgcgcagaagtactcagcctcatccgcggctaa

DBGET integrated database retrieval system