KEGG   Corynebacterium diphtheriae HC01: CDHC01_2235Help
Entry
CDHC01_2235       CDS       T01693                                 

Gene name
trpC1
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
cdt  Corynebacterium diphtheriae HC01
Pathway
cdt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cdt01100  Metabolic pathways
cdt01110  Biosynthesis of secondary metabolites
cdt01130  Biosynthesis of antibiotics
cdt01230  Biosynthesis of amino acids
Module
cdt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdt00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDHC01_2235 (trpC1)
Enzymes [BR:cdt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CDHC01_2235 (trpC1)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     CDHC01_2235 (trpC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: AEX75476
Position
2399782..2401239
Genome map
AA seq 485 aa AA seqDB search
MQNDSSTSPMPTVLESIVSGRRSHLPEIQARISHVDPARLLRSTRSLFQSLGGRSDGGPA
LRGSARFIMECKSSSPSLGMIREDYRPGDIARVYSRYAAGISVLCEPDRFGGDYNHLATV
AAATHLPVLCKDFIIHPVQVHAARYFGADAILLMLSVLDDATYTELSQEAARLGLDVLTE
VINEVEVERAIRLGATIFGINHRNLHDLSIDLNRSARLAPLIPDSAVIVSESGIRDNETV
RQLSGHSSAFLVGSQLTSQPDVDRAARELVYGHNKVCGLQSPSEAQAARASGAIYGGLIF
EESSPRNVSRETSKKIMAAEPELTYVAVSRRTTGWAEIIGDNIAVAQIHSPYQGSIAAEK
ELINHVRGEVGDKVKIWRAVSMTHADGSLVAEALAPEVDRLVLDTGNGGTGTAFDWARIP
ESVKSKALLAGGIGPDNITEALVVGCAGLDLNSGLEYPAEAGKWATHKDAAAIHSTFTQI
RGFHY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatgattcgtcgacaagccccatgcccaccgtcctagaatccatcgtttcgggc
cgacgatcccacctgcccgaaatccaggcgcggatttctcacgtggacccggcgcgacta
ctgcgttccacccgctcgctgtttcagtcgttgggaggccgtagcgatggcggtccggcg
ttgcgggggagtgcgcgcttcatcatggagtgtaagtcctcttcgccgtcgcttggcatg
attcgtgaggattatcgccctggcgacatcgcgcgggtgtattcacgttatgcggccggc
atttcggtgttgtgcgagccggatcgttttggtggcgactacaaccatctggccacggtg
gcggctgccacgcatcttccagtgttatgcaaggattttattatccaccctgtgcaggtt
cacgcggcccgttattttggggcggacgcaattttgctcatgttgagtgtgcttgacgac
gccacctacaccgagctcagccaggaagcagcacgcttggggttggatgttctcaccgag
gttatcaacgaggttgaggtggaacgtgccattcggttgggggctacaatctttggcatt
aatcatcgcaatctgcatgacttgagcattgatttgaatcgctcagcacgtcttgcgcca
ctgattcccgatagcgcagtgattgtctccgagtctggcattcgggacaacgagacggtt
cgccaactcagcgggcattccagtgcgttcctcgtaggctcgcagcttacttctcagcca
gatgtggaccgcgcggcccgtgagcttgtgtacggccacaataaggtgtgcggtttgcag
tcgccaagcgaggcgcaagcagcgcgcgcatcgggtgcaatctatggcggattgatcttc
gaggagtctagtccgcgtaatgtttcacgtgaaacatcgaaaaaaatcatggctgccgaa
cccgaacttacctatgtcgccgtctcacgacgcaccaccggatgggccgaaatcataggt
gacaacatcgccgttgctcagattcacagtccttaccagggctccatcgccgccgaaaaa
gaactcattaaccatgtgcgcggcgaggtaggagacaaggtaaaaatctggcgtgcggtc
tccatgacgcatgccgacggctcccttgtcgccgaggcgctcgcacccgaggtagacaga
ctcgtcctcgacaccggcaatggcggaaccggcaccgccttcgattgggcacgcatccca
gaatccgtgaagagcaaggctcttctcgccggcggcattggaccagacaatatcaccgag
gcgctcgtcgttggctgcgcaggactcgatctcaactccgggttggaatatccagccgaa
gcggggaagtgggcaacacacaaagacgctgctgcaatccactccactttcacccaaata
cgtgggtttcattactaa

DBGET integrated database retrieval system