KEGG   Corynebacterium diphtheriae HC01: CDHC01_2239Help
Entry
CDHC01_2239       CDS       T01693                                 

Gene name
trpB2
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cdt  Corynebacterium diphtheriae HC01
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CDHC01_2239 (trpB2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDHC01_2239 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDHC01_2239 (trpB2)
Enzymes [BR:cdt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CDHC01_2239 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
2403660..2404886
Genome map
AA seq 408 aa AA seqDB search
MKHTLLPAYFGEFGGQYVPESLIPALDQLEAAFVEAQNDPEFRAELAGYLKDYLGRPTPL
TLCSKLPKAGKGKGHARIFLKREDLVHGGAHKTNQVIGQALLAKRMGKTRIIAETGAGQH
GTATALACALLDLDCVIYMGAKDVERQQPNVYRMELMGAKVVPVDSGSGTLKDAVNEALR
DWTATFHESHYLLGTAAGPHPFPTIVREFHRVISEEAKAQILEQTGALPDVVVACVGGGS
NAIGMFADFIDDPSVELVGAEPGGMGLSSGKHGATINNGQIGILHGARSYLMRNSDGQVE
ESYSISAGLDYPGVGPQHAHLAKSGRARYVAITDAEALEAFQLLSREEGIIPALESSHAL
AYALKRAVLAEENNEDITIVVSLSGRGDKDIDHIRRTLSAHPELVVKD
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacacactgctaccggcatacttcggagaattcggcggacaatacgtacccgaa
tcccttatccccgccctcgaccaattagaagcggccttcgtggaagcgcaaaacgatccc
gagtttagagccgaactcgccggctacctcaaggactacctcggtcgtcccacgccactc
acgctctgctccaagctacccaaagccggaaaagggaaggggcacgcgcggatcttcctc
aaacgagaagacctcgttcacggcggcgcacacaaaaccaaccaagtaatcggccaagcc
cttttagctaaacgcatgggtaaaacccgcattattgctgaaaccggtgctggacaacac
ggaaccgccaccgcactcgcatgcgcactgctcgacctcgactgcgtgatctacatgggc
gctaaagatgtggaacgccaacaacccaacgtgtaccgcatggagctcatgggcgccaag
gtcgtaccagtcgactccggctccggaaccctcaaagatgcagtcaacgaagcactgcgc
gattggaccgcaaccttccacgagtcacactatctgcttggcaccgcagccgggccacac
ccatttcccacgattgtgcgcgaattccaccgcgtaatctcagaagaggccaaagcccaa
atacttgagcaaaccggtgcactgccagatgtggtggtcgcctgcgtcggcggcggatcc
aacgccatcggcatgttcgccgactttatcgacgacccctcagtagaactcgtcggcgca
gaaccaggcggaatgggactaagctccggaaaacacggcgctaccatcaacaacggccaa
atcggtattttgcatggcgccagaagctacctcatgcgcaactccgatggccaagtagag
gaatcctattctatttcagccggcctcgactacccaggtgtcggcccacaacacgcccat
ctagcaaagtctgggcgcgcccgctatgtcgccatcactgatgcggaagcactcgaagca
ttccaattgctctcccgcgaagagggcatcatcccggccttggaatccagccacgctctt
gcctatgcactcaaacgcgccgtcctcgctgaggaaaacaacgaagatatcaccatcgtg
gtgtccttgtctggccgtggcgacaaagacatcgaccacatccgccgcactctttccgcc
cacccagagctggttgtaaaggactaa

DBGET integrated database retrieval system