KEGG   Corynebacterium diphtheriae HC01: CDHC01_2240Help
Entry
CDHC01_2240       CDS       T01693                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cdt  Corynebacterium diphtheriae HC01
Pathway
cdt00260  Glycine, serine and threonine metabolism
cdt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cdt01100  Metabolic pathways
cdt01110  Biosynthesis of secondary metabolites
cdt01130  Biosynthesis of antibiotics
cdt01230  Biosynthesis of amino acids
Module
cdt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDHC01_2240 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDHC01_2240 (trpA)
Enzymes [BR:cdt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CDHC01_2240 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA IMPDH His_biosynth
Motif
Other DBs
NCBI-ProteinID: AEX75481
Position
2404891..2405727
Genome map
AA seq 278 aa AA seqDB search
MTRYTKLFSALSAKNEGAFVPFIMLGAPTPEASLAIIRTVVAAGADALELGVPFSDPVAD
GPTIQRSHLRALDNGATVDSSLELIRQIRKEFPELPIGMLIYGNVAFTRGITQFYQEFAD
AGVDSILLPDVPVREGEPFIAAAKQAGIDPIFIAPAQASEATLEGVAQHSSGYIYAISRD
GVTGTERQSSTRGLDKVVANVKRFGGAPILLGFGISTPEHVRDAIAAGASGAITGSALTS
IIERHTTGTHPEPAQVTDLEALTEEIFAFVKDMKAATR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgactcgctacaccaaattattctccgcactcagcgccaaaaacgaaggtgcattcgtc
cccttcatcatgctgggtgctcccaccccagaggcgtcgttagcaatcatccgtaccgtc
gttgccgcgggtgccgacgccctcgaactcggcgtccccttctccgacccagtagcagac
ggccccacaatccaacgctcccacctccgtgccctcgacaacggagccaccgtcgatagc
tcgctggaactgatccgacagatccgcaaagaattccccgaacttcccatcggcatgctc
atctacggcaacgttgccttcacccgcgggatcacccagttctatcaagaattcgccgac
gccggcgtagactccatcctgcttcccgacgtccctgtccgcgaaggcgagcctttcatc
gcagccgccaagcaagctggaatcgaccccatcttcatcgcccccgcacaagcctcggaa
gcaaccttggaaggggtagcgcaacactccagcggatacatctacgctatctcccgcgat
ggtgtgaccggaaccgaacgccaatcctctactaggggactagacaaagtggtggcaaat
gtgaaacgtttcggcggcgcaccgatcctgctcggttttggtatctccactcccgagcat
gtgcgcgacgccatcgcggcaggagccagcggcgccattacaggctccgcgctgacgtcg
atcatcgagcggcacaccacaggcacacacccagagccagcccaagtgacagaccttgag
gctctcaccgaagaaattttcgcgttcgttaaagacatgaaagccgcaacccgttaa

DBGET integrated database retrieval system