KEGG   Candida dubliniensis: CD36_00370Help
Entry
CD36_00370        CDS       T01140                                 

Definition
deubiquitinating enzyme 6, putative (EC:3.1.2.15)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
cdu  Candida dubliniensis
Brite
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CD36_00370
Peptidases [BR:cdu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CD36_00370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:join(81337..81349,81416..82839)
Genome map
AA seq 478 aa AA seqDB search
MAYTITIKNAGKTYDIELQEEDNGQILKSKIQELTLIPPERQKILIKGGKLTDEVIVSSL
NLKSPVMVLGTPDKNLPSKPVEKQVFLEDLNKSQLVKVSNEPSGLTNLGNTCYLNSSLQT
IFHIEDVNNKLKDYTFGGANQANSAFVLSLKSMFQQMSKKHEVITPSTFLSLFRRSYPQF
AEQQNGIYKQQDAEEAFSQIMSSLRSELKIDDVFKITFNTKTQCLAIPEDVTEGFEEAFK
LNCHIDVKTNFLRDGLLAGLKETIEKHNSTLNADTDYEITKTITRLPKYLTVHFIRFFWK
RDINKKSKILRKVQFPFELDLAEMLDVSIKPDKVSNRDTIRKVEKDNLDLIRDFKKAKKD
TNLTPLEQQEEEEMKITSIKSKFREDLNSALPNVDFNATTENPSSVYELNAVITHAGSSA
DGGHYKAYVKDPTDLDGERWWLFNDDKVSPVNKEKIETLAGGGESDSALLLVYKGLGL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacacaatcactatcaaaaacgcaggtaaaacttacgacattgaacttcaagaa
gaagacaatggccagatattaaagtctaaaattcaggaattgacattgatcccaccagaa
agacaaaaaatcttgattaagggtggtaaattgactgatgaggtgattgtgtctagttta
aacttgaaaagtccagtaatggttttaggtactcctgataagaacttaccttcgaagcca
gttgaaaaacaagttttccttgaagatttgaataaaagtcaattggttaaggttagtaac
gaacctagtgggttgaccaatttggggaacacatgctacttgaattcaagtttacaaacg
atatttcatatcgaggatgtgaataacaagttgaaagattacacttttggtggagccaat
caagctaatagtgcctttgtgttgtcattgaaaagtatgtttcaacaaatgtcgaaaaaa
cacgaagttattactccttccacatttctttctcttttcagaaggtcttatcctcaattt
gctgaacaacaaaatggtatttataaacagcaagatgcagaagaagcattttcccaaatt
atgagttctttgaggagcgaattgaaaatagatgatgtgtttaaaataacattcaacacc
aagactcagtgtttggctatcccagaagatgtcacagaagggtttgaagaggcatttaaa
ttgaattgtcacattgatgtcaagaccaattttttgagagatggattgttagctggatta
aaagaaactattgagaaacataattcaactttgaacgctgatactgattatgaaataacc
aagactataactagattaccgaaatacttgacagtgcattttatcagattcttctggaaa
cgagacatcaataaaaagtccaagattttgagaaaagttcaattcccatttgaattagat
ttagcagagatgttagatgtatccataaagcctgataaagtttctaatagagatacaatt
agaaaagttgaaaaagataatttggatttgataagagatttcaaaaaggccaaaaaggac
accaatttgacaccattggagcaacaagaggaagaagaaatgaaaataacatcaatcaaa
agtaagtttagggaagacttgaacagcgctttgcccaatgttgattttaatgccaccaca
gaaaatccttctagtgtatacgagttgaacgctgttattacacatgctggatcatctgct
gatgggggtcattacaaagcttacgtcaaggatccaacagacttggacggcgagagatgg
tggttgtttaatgatgacaaagtaagcccagtaaacaaagagaaaatcgaaactttagct
ggtggtggtgaaagtgactcagctttattattggtttacaaaggtttagggctttag

DBGET integrated database retrieval system