KEGG   Candida dubliniensis: CD36_01660Help
Entry
CD36_01660        CDS       T01140                                 

Definition
cyclin, putative
Orthology
K06634  
cyclin H
Organism
cdu  Candida dubliniensis
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CD36_01660
  Replication and repair
   03420 Nucleotide excision repair
    CD36_01660
Transcription machinery [BR:cdu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CD36_01660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(393344..394537)
Genome map
AA seq 397 aa AA seqDB search
MSEVKNELETEATPVPIKKQRLSNDDLYRNSTQYELWSFTQETLQDAKREANEKGVKISK
ERFKFAFENAKKEHPDVFEQYPDELNENMVSLLTLEEESTYLDFYIQNITTTCNFFKMPT
QVRLTAASFFKKFYLVNSVMEFHPKNVLYTCIFLAAKSENYFISIESYVKALKGTNTSHI
LDLEFIVLQSLKFTLLVHHPIRALYGFFLDFQAVLLHPEQVMYDVSVDTLGNMYNQAKEW
LNKYFMVSDVAFLFTPPQIALAAMYDTDKRITDKYLKRKYLSNEDKLDPIKEQENEPEIE
KQNGEDKSAITSEEQSKNVVKEKTKSTNRQQYETLVTLMRKCVKLAKQSQVADREASKEI
DKKCFFALNPKKLIDKRIKRLASGNQDIAKEGTVEPS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagtaaagaatgaattggaaacggaagcgactccagtaccaattaagaaacaa
agactatcaaatgatgatttgtatcgaaattcgactcaatacgagttatggtcatttacc
caagagacattacaagatgccaaacgagaggcaaatgaaaagggagtcaaaatatcaaaa
gaaagatttaagtttgcctttgagaatgcaaagaaagaacacccagacgtttttgaacaa
tatccggatgaattgaacgaaaatatggttagtctattaaccctagaagaagagtctacc
tatcttgatttttacatacaaaacatcactacgacatgcaattttttcaaaatgccaact
caagttcgcttaacggcagcttcatttttcaagaaattttacctagtcaactcagtgatg
gagtttcatcctaaaaatgtactatatacgtgtatattcctagctgcaaagtcagaaaat
tatttcatctccatagaatcatatgttaaggcactaaaggggacaaatacatctcatatt
ctagacttagagtttattgtgttacaaagtttgaagtttacattgttggtgcatcatcca
atacgagcattgtacgggtttttcctagattttcaggctgtattgttgcacccggaacaa
gtaatgtatgatgtatcagtggatactttggggaacatgtacaatcaagcaaaggaatgg
ctcaacaagtattttatggtgagtgatgtggcgtttttgtttacgcccccgcagattgcg
cttgcggcaatgtatgatactgacaaaaggattactgataaatacttgaaacgaaaatat
cttagcaatgaggacaaattggatccgataaaggaacaggaaaatgagccggaaattgaa
aagcaaaatggtgaagataagtctgcaattacatccgaagaacagtcaaaaaatgttgtg
aaagaaaagactaaatcaaccaatagacagcaatatgaaacgttggttacactaatgaga
aagtgcgtaaaacttgccaagcagtcgcaagttgctgatcgtgaagcaagcaaggaaatt
gataaaaagtgtttttttgcattaaatccgaagaaattgattgataaaagaatcaaaaga
ttagcttcagggaatcaggatattgcaaaagaaggtacagttgaacctctgtaa

DBGET integrated database retrieval system