KEGG   Candida dubliniensis: CD36_01660Help
Entry
CD36_01660        CDS       T01140                                 

Definition
cyclin, putative
Orthology
K06634  
cyclin H
Organism
cdu  Candida dubliniensis
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:cdu03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:cdu03420]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(393344..394537)
Genome map
AA seq 397 aa AA seqDB search
MSEVKNELETEATPVPIKKQRLSNDDLYRNSTQYELWSFTQETLQDAKREANEKGVKISK
ERFKFAFENAKKEHPDVFEQYPDELNENMVSLLTLEEESTYLDFYIQNITTTCNFFKMPT
QVRLTAASFFKKFYLVNSVMEFHPKNVLYTCIFLAAKSENYFISIESYVKALKGTNTSHI
LDLEFIVLQSLKFTLLVHHPIRALYGFFLDFQAVLLHPEQVMYDVSVDTLGNMYNQAKEW
LNKYFMVSDVAFLFTPPQIALAAMYDTDKRITDKYLKRKYLSNEDKLDPIKEQENEPEIE
KQNGEDKSAITSEEQSKNVVKEKTKSTNRQQYETLVTLMRKCVKLAKQSQVADREASKEI
DKKCFFALNPKKLIDKRIKRLASGNQDIAKEGTVEPS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagtaaagaatgaattggaaacggaagcgactccagtaccaattaagaaacaa
agactatcaaatgatgatttgtatcgaaattcgactcaatacgagttatggtcatttacc
caagagacattacaagatgccaaacgagaggcaaatgaaaagggagtcaaaatatcaaaa
gaaagatttaagtttgcctttgagaatgcaaagaaagaacacccagacgtttttgaacaa
tatccggatgaattgaacgaaaatatggttagtctattaaccctagaagaagagtctacc
tatcttgatttttacatacaaaacatcactacgacatgcaattttttcaaaatgccaact
caagttcgcttaacggcagcttcatttttcaagaaattttacctagtcaactcagtgatg
gagtttcatcctaaaaatgtactatatacgtgtatattcctagctgcaaagtcagaaaat
tatttcatctccatagaatcatatgttaaggcactaaaggggacaaatacatctcatatt
ctagacttagagtttattgtgttacaaagtttgaagtttacattgttggtgcatcatcca
atacgagcattgtacgggtttttcctagattttcaggctgtattgttgcacccggaacaa
gtaatgtatgatgtatcagtggatactttggggaacatgtacaatcaagcaaaggaatgg
ctcaacaagtattttatggtgagtgatgtggcgtttttgtttacgcccccgcagattgcg
cttgcggcaatgtatgatactgacaaaaggattactgataaatacttgaaacgaaaatat
cttagcaatgaggacaaattggatccgataaaggaacaggaaaatgagccggaaattgaa
aagcaaaatggtgaagataagtctgcaattacatccgaagaacagtcaaaaaatgttgtg
aaagaaaagactaaatcaaccaatagacagcaatatgaaacgttggttacactaatgaga
aagtgcgtaaaacttgccaagcagtcgcaagttgctgatcgtgaagcaagcaaggaaatt
gataaaaagtgtttttttgcattaaatccgaagaaattgattgataaaagaatcaaaaga
ttagcttcagggaatcaggatattgcaaaagaaggtacagttgaacctctgtaa

DBGET integrated database retrieval system