KEGG   Candida dubliniensis: CD36_03120Help
Entry
CD36_03120        CDS       T01140                                 

Definition
enoyl-CoA hydratase/isomerase-family member involved in endocytic membrane trafficking, putative
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
cdu  Candida dubliniensis
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CD36_03120
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CD36_03120
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CD36_03120
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CD36_03120
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     CD36_03120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(713084..714592)
Genome map
AA seq 502 aa AA seqDB search
MLRFNNSSSLLKQIRKIATTSINMSSKLSSNHTSGGEEPVVLSSVKNHARLITLNRVKKL
NSLNTEMIELMTPPILDYAKSKENNVIILTSNSPKALCAGGDVAECAVQIRKGNPGYGAD
FFDKEYNLNYIISTLPKPYISFMDGITFGGGVGLSVHAPFRVATEKTKLAMPEMDIGFFP
DVGTTFFLPRLNDKLGYYVALTGSVLPGLDAYFAGFATHYIKSEKIPQLINRLADLQPPA
IEGDITVLSGNNQYFNQVNDILNDFSEKKLPEDYKFFLSTEDIATINKAFSQNTIDDVLK
YLENDGSPFAKKTLETLLKKPKSSLAVGFELMNHGAKNSIKKQFELEMVSATNIMSIPAD
QNDFAKGVIHKLVDKIKDPFFPKWNDPSTVTQQFLKNILSTSKNTDKYLKAPFIKKWFGV
DFEDYPHQMGLPTNKQVADYISGSDGSNRTYLPTPAEVFKHFKQKTNNKLGVEEKIRQIL
DLHGETAKYDHKYVTWKEDPTK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgttacgattcaacaattcttctagtttattgaaacaaatcaggaaaattgccaccact
tctattaatatgtcatcaaaattatcaagcaaccacacctctggaggtgaagagccagtt
gtattgagttcagtgaaaaaccatgctagacttattaccctcaacagagtcaagaaattg
aattcattaaacacagaaatgattgagttgatgaccccaccaattttggattacgccaaa
tcaaaggaaaacaatgttatcatattgacttcaaattcccccaaggctttgtgtgctggt
ggtgatgttgctgaatgtgccgttcaaatcagaaagggaaatccaggatatggagctgat
ttttttgacaaagaatataacctcaattatatcatttcgactttaccaaaaccatatatt
tcatttatggatggaatcacttttggaggaggtgttgggttatcagtacatgcaccattt
cgagtagcaactgaaaaaaccaaacttgctatgccagaaatggatataggattctttcca
gatgtcggcactacattctttttacctagattaaacgataagttgggatattatgtggct
ttgacaggctctgttttgcctggattagatgcttactttgctggatttgcaactcattac
attaagtctgaaaaaatccctcaattgatcaacagattagcagatttgcagccaccagca
attgaaggtgatattaccgtcctatcgggcaacaatcaatatttcaatcaagtaaatgat
attttgaatgattttagtgaaaagaaattacccgaagactacaagtttttcctttccact
gaagatattgcaacaataaacaaagcattttctcaaaacactattgatgatgttctcaaa
tatttggagaatgatggatctccatttgccaaaaagacacttgaaacattattgaaaaag
cccaagagttcattagctgtagggtttgaattgatgaaccacggagcaaagaattctatc
aaaaaacagtttgaattggagatggtttctgcaactaatatcatgagtatcccagcagac
caaaatgattttgctaaaggtgttattcataaattagtggacaaaatcaaggatccattt
ttccctaaatggaatgatccaagcactgttactcaacaattccttaaaaacatcctcagc
acatcgaaaaacaccgacaagtatttgaaagctccgtttatcaaaaaatggttcggcgtc
gattttgaggactatccacaccaaatgggattgcctacaaataaacaagttgcagattat
atttctggatcagatggatctaatagaacctatttaccaactcccgcggaagttttcaaa
cattttaaacaaaagacaaataataaattgggtgtcgaggagaagattagacagatattg
gatttacacggcgaaaccgccaaatacgatcataagtatgttacttggaaagaagatccc
acaaaataa

DBGET integrated database retrieval system