KEGG   Candida dubliniensis: CD36_04070Help
Entry
CD36_04070        CDS       T01140                                 

Definition
phosphoglycerate mutase 1 (GPM1), putative
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cdu  Candida dubliniensis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CD36_04070
   01230 Biosynthesis of amino acids
    CD36_04070
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD36_04070
  Energy metabolism
   00680 Methane metabolism
    CD36_04070
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CD36_04070
Enzymes [BR:cdu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CD36_04070
Exosome [BR:cdu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CD36_04070
  Exosomal proteins of melanoma cells
   CD36_04070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:924499..925284
Genome map
AA seq 261 aa AA seqDB search
MAVHKLIILRHGESQWNQENKFCGWIDIPLSQKGKQEAIYAGELIKRNHLDPDILYTSKL
MRSIETGLTILEVLQKPWIDHIKTWRLNERHYGQYQGRDKHEVFVELGKDKEKFQYIRRN
YHGLPPLIEYGQDKSIDEKYNDILNKDILPRGESLSMVMERLIPFFKYEILDNQMIQLNK
TVLIVTHGSIVRSLIKYLNHVSDDDISKINVPTGIPLVFELNDRGELIKPYYYLDQEKAE
KGIAKVKMEGLERKGQTDEKL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggccgttcataaattaataattctaagacatggtgaatcacaatggaatcaagaaaat
aaattctgtggatggattgatattccattatcacaaaagggcaaacaagaagcaatttat
gctggagaattaattaaaagaaaccatcttgatcctgatattttatatacttcgaaatta
atgcggtctatagaaactggattgacaattttagaagtgttacagaaaccatggattgat
catattaaaacttggagattgaatgaacgacattacggtcaatatcaaggaagagataaa
catgaagtgtttgttgaattggggaaagataaagagaaattccaatatattagaagaaat
tatcatggattaccacctttaatagaatatggtcaagataaatcaattgatgaaaaatac
aatgatatattaaataaagatatattacctcgaggagaatcattactgatggtaatggaa
agattgattccatttttcaaatatgaaatattagacaatcaaatgattcaattaaataaa
actgttttgatagtgacccatggatcaattgttagaagtttgatcaaatatcttaaccat
gtcagtgatgatgatatatcaaagattaatgtccccacagggataccattggtgtttgaa
ttgaatgatagaggtgaattaatcaagccttattattatttggatcaagaaaaggcagaa
aagggaattgccaaagtgaaaatggaaggtcttgaaagaaaaggacaaacagatgaaaaa
ctatag

DBGET integrated database retrieval system