KEGG   Candida dubliniensis: CD36_04070Help
Entry
CD36_04070        CDS       T01140                                 

Definition
phosphoglycerate mutase 1 (GPM1), putative
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cdu  Candida dubliniensis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:cdu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cdu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cdu00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:cdu00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cdu00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:924499..925284
Genome map
AA seq 261 aa AA seqDB search
MAVHKLIILRHGESQWNQENKFCGWIDIPLSQKGKQEAIYAGELIKRNHLDPDILYTSKL
MRSIETGLTILEVLQKPWIDHIKTWRLNERHYGQYQGRDKHEVFVELGKDKEKFQYIRRN
YHGLPPLIEYGQDKSIDEKYNDILNKDILPRGESLSMVMERLIPFFKYEILDNQMIQLNK
TVLIVTHGSIVRSLIKYLNHVSDDDISKINVPTGIPLVFELNDRGELIKPYYYLDQEKAE
KGIAKVKMEGLERKGQTDEKL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggccgttcataaattaataattctaagacatggtgaatcacaatggaatcaagaaaat
aaattctgtggatggattgatattccattatcacaaaagggcaaacaagaagcaatttat
gctggagaattaattaaaagaaaccatcttgatcctgatattttatatacttcgaaatta
atgcggtctatagaaactggattgacaattttagaagtgttacagaaaccatggattgat
catattaaaacttggagattgaatgaacgacattacggtcaatatcaaggaagagataaa
catgaagtgtttgttgaattggggaaagataaagagaaattccaatatattagaagaaat
tatcatggattaccacctttaatagaatatggtcaagataaatcaattgatgaaaaatac
aatgatatattaaataaagatatattacctcgaggagaatcattactgatggtaatggaa
agattgattccatttttcaaatatgaaatattagacaatcaaatgattcaattaaataaa
actgttttgatagtgacccatggatcaattgttagaagtttgatcaaatatcttaaccat
gtcagtgatgatgatatatcaaagattaatgtccccacagggataccattggtgtttgaa
ttgaatgatagaggtgaattaatcaagccttattattatttggatcaagaaaaggcagaa
aagggaattgccaaagtgaaaatggaaggtcttgaaagaaaaggacaaacagatgaaaaa
ctatag

DBGET integrated database retrieval system