KEGG   Candida dubliniensis: CD36_04240Help
Entry
CD36_04240        CDS       T01140                                 

Definition
isocitrate lyase, putative
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cdu  Candida dubliniensis
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:cdu01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:cdu00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:958475..960127
Genome map
AA seq 550 aa AA seqDB search
MPYTPVDIQKEEADFQKEVAEIKKWWSEPRWRKTKRIYSAEDIAKKRGTLKINHPSSQQA
DKLFKLLEKHDADKTVSFTFGALDPIHVAQMAKYLDSIYVSGWQCSSTASTSNEPSPDLA
DYPMDTVPNKVEHLWFAQLFHDRKQREERLTLSKEERAKTPYIDFLRPIIADADTGHGGI
TAIIKLTKMFIERGAAGIHIEDQAPGTKKCGHMAGKVLVPVQEHINRLVAIRASADIFGS
NLLAVARTDSEAATLITSTIDHRDHYFIIGATNPEAGDLAALMAEAESKGIYGDKLAAIE
AEWTKKAGLKLFHEAVIDEIKSGNYSNKDALIKKFTDKVNPLSHTSHKEAKKLAKELTGK
DIYFNWDVARAREGYYRYQGGTQCAVMRGRAFAPYADLIWMESALPDYAQAKEFADGVKA
AVPDQWLAYNLSPSFNWNKAMPADEQETYIKRLGKLGYVWQFITLAGLHTTALAVDDFSN
QYSQIGMRAYGQTVQQPEIEKGVEVVKHQKWSGATYIDGLLKMVSGGVTSTAAMGQGVTE
DQFKESKAKA
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgccttacactcctgttgacattcaaaaagaagaagctgacttccaaaaagaagttgct
gaaatcaaaaaatggtggtccgaaccaagatggagaaagaccaagagaatctattctgct
gaagacattgctaagaaaagaggaaccttgaaaatcaaccatccatcatctcaacaagcc
gacaaattgttcaaattgttggaaaaacatgatgctgataagactgtttcttttactttt
ggtgctttagacccaatccacgttgctcaaatggccaaatacttggactctatttacgtt
tccggatggcaatgttcttctaccgcctccacttctaatgaaccatctccagatttggct
gattatcctatggataccgtcccaaacaaggttgaacatttgtggtttgctcagttgttc
catgacagaaaacaaagagaagaaagattgactttatctaaagaagaaagagccaaaacc
ccatacattgacttcttgagaccaatcattgctgatgccgatactggtcatggtggtatc
actgctatcatcaaattaaccaagatgtttattgaaagaggtgctgctggtatccatatt
gaagatcaagctccaggtaccaagaaatgtggccatatggctggtaaagtgttagtccca
gtccaagaacacattaacagattggttgccattagagcttctgctgatatttttggatcc
aacttgttggccgttgccagaacagactctgaagctgctaccttgattacctccaccatc
gaccacagagaccattactttatcattggtgccacaaacccagaagctggtgatttagct
gcattgatggctgaagctgaatctaagggtatctacggtgataaattagctgctattgaa
gctgaatggaccaaaaaagccggcttaaaattgttccacgaagctgttatcgatgaaatc
aagagcggtaactactctaacaaagatgctttgatcaaaaaattcactgataaagtaaac
ccattgtctcacacttctcacaaagaagctaagaaattggccaaggaattgactggtaaa
gatatttacttcaactgggatgttgccagagccagagaaggttactacagataccaaggt
ggtactcaatgtgccgtcatgagaggtagagcttttgctccttatgctgatttgatttgg
atggaatctgccttaccagattatgctcaagctaaagagtttgctgacggtgttaaagct
gctgttccagatcaatggttggcttacaacttgtctccatctttcaactggaacaaggcc
atgccagctgatgaacaagaaacttatatcaagagattgggtaaattaggttacgtgtgg
caattcatcaccttggccggtttgcacaccactgccttggctgttgacgatttctctaac
caatactctcaaatcggtatgagagcttatggtcaaactgttcaacaaccagaaatcgaa
aaaggtgtggaagttgttaagcatcaaaaatggtctggtgccacctacattgatggtttg
ttgaagatggttagtggtggtgttacctccaccgctgctatgggtcaaggtgttactgaa
gatcaattcaaggaatccaaagccaaagcttaa

DBGET integrated database retrieval system