KEGG   Candida dubliniensis: CD36_05180Help
Entry
CD36_05180        CDS       T01140                                 

Definition
WD-repeat MIP1-like developmental modulator, putative
Orthology
K07204  
regulatory associated protein of mTOR
Organism
cdu  Candida dubliniensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1181484..1185764
Genome map
AA seq 1426 aa AA seqDB search
MSTSQELYTSLGRRPPQQPLNDKMRHGFEVDYNSEKFLNSLANTFYIYFDDKRQNTNGNP
LTEEMKQSAELFKNYQPISDWKVMKERQKTINAILVLCLNLGVAPPDVMKPSPCARFESW
CDPSTFNDTKKAIENIGKNLQTQYENISSKTRYRQSLDPCVEDVKRFCNTQRRNAKDERI
LFHYNGHGVPKPTASGEIWVFNRNYTQYIPISLYDLQTWLGAPVIFVYDCNSAGNIVHNF
KKFVQKRIDDDNDGNHDQSAPSPTSAYLDCIQLAACKSNELLPMSPDLPADLFTCCLTSP
IDISIRWFIIQSSLKKGYYDALPRNSIGNIIIPGNLNDRRTPLGELNWIFTAITDTIAWT
SLTRPIFKRLFRQDLMVAALFRNFLLAKRIMPHLNCNPISDPPLPDAVRFHPIWDSWDLA
IDQVLSRLLKSAKETTTLPLAGNNQNGGAAKGDSVSSVQQQANGSQTTALFPNLGNVQYT
TFFEQQLTAFEIWLKFEGPSSKTPPEQLPIVLQVLLSQVHRLRALILLSQFLDLGPWAVY
LSLSIGIFPYVLRLLQSPAQELKPVLIFIWARIMAVDYKGTQQELCKDKGYNYFYSILNS
PPINHVGVNGNAIVSSGAMLINDDHKAMSAFILTLFIKDFKNGQRLCFSSEIVTNCLKFI
QTSDNPLLRQWCNLLLSQLWNRYPEGKWVIYKNNYITKLLNLIDDPIPEVRTSILVALTT
YLSDPPHLASQQPPNPVAVNTNDLRKDEIRQQDLKLANAVLGLLGDGSPIVRKELVYFIN
KFVQTYAKFFLVVAFNQLQEEIVLIENPNYLNDFRKRSPAYGSIFSSVWKALLILSEDPH
CEVKQLAETLIDYVMVQLNESELSSLVKEMQDYLLSKSTINISESFKPTKPVVNRQLGEN
RLSSSASVGNRRNTLLIDGSSLTTRSASANNISSNHTKGNMDDSDAESITSRIKSLSVSK
LFKSFHITEENDMNSFTRILNPGPVQSNYGSEYIPKTAFFKKRDLSKAPELPIESGFFEY
SCEYFQEPQMSRNEIDEPGSKEYVKRLWRRNRNESIIQETQPQKEMALRGEWNKDIQILN
NITQPKCIKFTQFEKILVASDEKDNMTVWDWGNGQVVKKFSNGNPFGTKITDIKFLNEDD
LPLLLTGSSDGVIKIYKNFHNYENSNSSDKDEDGFDEEKRVELVTGWRALTDLLLTSKST
GLVSEWQQSRGSLLVSGDVKIIRIWDAPRELCLSDIPARSSSSITSLTSDQVAGDIFIAG
FDDGSIRVYDTRLDSRESMVMTWKPTKQHPGLQQSNYTGLGSIRNVHMQRGGFRELISGS
SDGIVNIWDLRLHDPVMTYATPNKSMRTMDVHEHAPILMTGLKTVDIWSTAGECLTTLNN
PNGFSGRSLNYLSSTTFHPHRMMLATNYNQNGHINLYTCNDTVVEY
NT seq 4281 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacatcacaagaattatacacctcacttggaaggcggcctccccagcaaccgttg
aatgacaaaatgagacatgggtttgaagttgattacaattctgaaaaattcttaaattcc
ttagcaaatactttttacatatatttcgatgacaaacgtcaaaatacaaacggaaatcca
ttaacagaagaaatgaagcagtcggctgaactctttaaaaattatcaacctatatccgac
tggaaagttatgaaagaacggcaaaagaccatcaatgcaattttagtgctatgcttaaat
ttgggtgtggcaccaccagatgtaatgaagccatcgccatgtgcaagatttgaatcttgg
tgtgatccatccacttttaatgataccaagaaagcaatagagaatattgggaaaaatctt
cagacacaatacgaaaatatttcatcaaaaacgagataccgtcagtcgttggacccctgt
gttgaggacgtaaagaggttttgcaatactcaaagaagaaatgccaaagatgaaaggatt
ttgtttcactataacggccatggtgtacctaagccaactgctagtggagaaatatgggtg
ttcaatagaaattacactcagtacattcctatatcattgtatgatttgcagacatggcta
ggagcacccgtaatatttgtctatgactgtaatagtgctgggaatatagtgcataatttc
aaaaagtttgttcaaaagcgcatagatgacgataacgacgggaaccacgatcaaagtgca
ccttcgcctacttcggcctatcttgattgcatacagttggcagcttgtaaaagtaacgaa
ttgttaccgatgagtcctgatttaccagctgatttgtttacatgctgtttaacaagcccc
atagacataagtataaggtggtttatcattcaaagctcgttgaaaaaagggtactatgat
gcattacctagaaattcaataggtaatattattattcctggtaatttgaatgatcgaaga
accccattaggagagttgaattggatatttaccgctattacagatacaattgcatggact
tctttgactagacccatctttaaacgtttattcagacaagatttgatggttgctgcattg
ttcagaaattttttattggctaaaagaattatgccacatttgaattgtaatccaatcagt
gatccaccgttgccagatgcagttaggtttcacccaatttgggactcttgggatttagct
atagaccaagttctttccagattattgaaaagcgccaaagaaacaactaccttacctctt
gcaggcaacaaccaaaatggtggtgccgctaaaggtgattctgtgtcttctgtgcagcaa
caagccaatggatctcaaaccacggcattatttccaaatttaggtaatgttcagtacact
acattctttgaacagcaattgacggcttttgagatttggcttaaatttgaaggtccatca
tcaaaaacgccacctgaacaattaccaattgttttgcaagtattattatcgcaagtgcat
aggttgagagctctaattctattgtcacagtttttggatcttggcccgtgggcagtctac
ttatcattgtccattggtatcttcccctatgttttgcgtttattgcagagccctgcacaa
gaattaaaacctgtgttgatttttatttgggcaagaataatggcagttgattacaagggt
acccaacaagagttgtgcaaagataagggatacaattatttttactcaatactaaattca
cccccaataaatcacgtgggtgtgaatggtaatgcgattgttagttcaggtgctatgttg
attaacgatgatcataaagcaatgagtgcatttattttgactttgttcatcaaggacttt
aaaaacgggcaaaggttgtgtttttcttcggagattgttaccaattgtttaaaatttata
caaactagtgataatccattacttagacaatggtgtaatctattattatcgcagttgtgg
aatagatatcctgaaggtaaatgggtaatttataaaaacaattatatcactaaattattg
aacttgattgacgacccgatacctgaagtgaggacgtcaattcttgttgctttgaccact
tatctttcggacccacctcatttggcttctcagcaaccacctaaccctgttgctgtaaac
actaatgatttaagaaaagacgaaattagacagcaagatttgaaattagccaatgctgtg
cttggtctcttgggtgatggctcgcctattgtgcgaaaagagttggtgtatttcatcaat
aaatttgtccaaacatatgcaaagtttttcctagtcgttgcattcaatcaattgcaagaa
gaaattgtattaatcgagaaccccaattatttaaatgatttcaggaaaagatcccctgca
tatggatcaatatttagttcagtctggaaggcattgttgattttgtcagaggatccacat
tgtgaggtgaagcaattggcggaaactttgatagactatgttatggttcagttgaatgaa
agtgagttgtcaagtttggtgaaagaaatgcaagattatttattaagcaagtcaacaatt
aatatcagtgaaagcttcaagccaaccaagccagttgttaataggcagttgggtgaaaac
cgattatcctcaagtgcttccgttggtaatagacgaaataccttgttaatcgatggatct
tcactaacaaccagatcagcttctgctaataatatcagtagtaaccatactaaaggtaat
atggatgattcagacgctgagtcaattacatcaaggattaaaagtttgtccgtttcaaaa
cttttcaaaagtttccacattacagaagaaaacgacatgaatagtttcacaagaatcttg
aatccagggcccgttcaatcaaattatggaagtgagtatataccgaaaaccgcatttttt
aaaaagagagatttgtcaaaggctcctgagttgccaattgaatcggggttttttgagtat
agttgtgaatatttccaggaaccacaaatgtcgagaaatgaaattgatgagccaggctcc
aaggaatatgtgaagcgtttgtggagaagaaatagaaatgaatctattattcaagaaacg
caaccacagaaggagatggcgttaaggggtgaatggaataaagatatccagattcttaac
aatataacacaaccaaaatgtataaaatttacccaatttgaaaaaattttagttgcaagt
gacgaaaaggataatatgacagtttgggattggggaaatggtcaagttgttaaaaagttt
tcaaatggtaatccttttggtacaaaaatcaccgatataaagttcttaaatgaggatgat
ttgccgttattgttgactggttcatctgatggtgtgattaaaatttataagaacttccat
aattatgagaatagtaactccagtgacaaagatgaagatggctttgatgaggaaaaacga
gtagagctagttactggatggagagcattgactgatctattgttgacttcgaaaagtaca
ggtttggtgtcggaatggcagcaatcaagaggttcattgttggtaagtggtgacgtcaag
atcatcagaatatgggatgctccgcgtgagttgtgtttactggatattccagcgagatcc
tcgtcttcaatcacgtcattgacttccgatcaagtggccggggatatttttattgctggc
tttgatgatggcagtattagagtttatgataccagattagactctcgtgaatccatggtc
atgacatggaaaccaaccaaacaacaccctggtttacaacaatcaaactatacaggttta
gggtctattagaaacgtgcatatgcagcgaggcgggtttagggagttgataagtggttcc
tcagatgggattgtaaacatatgggatctcagattacatgaccctgtgatgacctatgcc
accccaaacaaatccatgcgaactatggatgtccacgaacatgcacctatcttgatgaca
ggtctcaaaactgttgatatatggtcaacagcaggtgaatgcttaacaacattaaataat
ccgaatggattctctggaagatcacttaattatttgtccagtactacattccaccctcat
agaatgatgcttgcaacgaactataaccaaaatggccatataaatctatatacatgtaat
gatactgttgttgaatactga

DBGET integrated database retrieval system