KEGG   Candida dubliniensis: CD36_05970Help
Entry
CD36_05970        CDS       T01140                                 

Definition
ubiquitin carboxyl-terminal hydrolase 1, putative (EC:3.1.2.15)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
cdu  Candida dubliniensis
Brite
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CD36_05970
Peptidases [BR:cdu01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   CD36_05970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1393882..1394634
Genome map
AA seq 250 aa AA seqDB search
MTKGDSKRVIPLESNPTLFTELAYQLGLSPLLQFHDVYSLTEPDLLAMLPTPIYAIILLF
PLSPNYEKYRQQQDNNSSQQNVPKYDNNNEIEWFKQTIGNGCGLYALLHILTNLPQDLII
SNSKLSQLLNDLKNLSKFSINDRALIIENLEKDIKLDENFGEKGDTIAPDINESVDLHFI
SFIKSPKNGHLYELDGRRTGPIDLGESNNDNNSSIINDPLLIEKIQFYIDNADEANKNNF
AIMAIGPSFE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaggtgattctaaaagagtgattccattagaatcaaacccaactttatttact
gaattagcttatcaattaggattatcaccattattacaatttcatgatgtttattcttta
actgaacctgatttattagcaatgttacccacaccaatatatgccattatattattattc
cccttaagtcccaattatgaaaaatatcgtcaacaacaagacaataactcctcccaacaa
aatgtaccaaaatatgataataataatgaaattgaatggtttaaacaaacaattggtaat
ggatgtggattatatgctttattacatattttaactaatctacctcaagatttaattatt
tctaattctaaattatctcaattattaaatgatttgaaaaatttatccaaattttctatt
aatgatcgagcattaattattgaaaatttagaaaaagatattaaattagatgaaaatttt
ggtgaaaaaggtgatactatagctcctgatattaatgaatcagttgatttacattttatt
tcatttattaaaagtcccaaaaatggtcatttatatgaattggatggtagaagaactgga
ccaattgatttgggtgaatcaaataatgacaataatagtagtattattaatgatccatta
ttaattgaaaaaattcaattctatatagataatgctgatgaagcaaataagaataatttt
gcaattatggcgattggtccttcttttgaatga

DBGET integrated database retrieval system