KEGG   Candida dubliniensis: CD36_06110Help
Entry
CD36_06110        CDS       T01140                                 

Definition
deubiquitinating enzyme 12, putative (EC:3.1.2.15)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
cdu  Candida dubliniensis
Brite
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CD36_06110
Peptidases [BR:cdu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CD36_06110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1423550..1427479)
Genome map
AA seq 1309 aa AA seqDB search
MSDNIEDRSKIPSDAKEIVTTNEIEATDSEHTTNVDNELRHNESNERTEEYHNDNLASKR
QLINDLLHNDVIKEGTERYIIPQDFLHEFLNLPIDNFSDLKEKLGPIDFHLVVDQQGILY
PENEEPVPSCHVSTKVFEYLGEWFGILGQPIIRAIIINPETKEKEIERNTPLFWVYQLGK
KTQPTYLRHRHNGSSHGHHHGHHDSPIPVSLSKTSTFYNLMDLIRYNVLKAPRKSMKDYR
IWFIIPQDKDLQYLISVQTFMFDISQKTLVSPNMLDDALKNQGIMANTYHIMVETKEKHQ
TEFPTDQFILSHSNAYEEVAQGGGHLGLSNMGNTCYMNSALQCLLHVPEINYYFFYNIYK
KELNFDNPLGYHGDVANAFGSLLKQAFDHVKNGSSISPREFKSTIGRYSSMFSGYLQQDS
QELLSWLLDALHEDLNRIHKKPYCEKPELKDDEIDDPQAINKLANTCWNQHKARNDSVII
DLFTGLYQSTLICPDCGKKSITFDPFNDLTLPLPISKKWYHTFTIVDLSNEGVIPERIMK
LEVELNKTSNFDDLLGYLSNFLNIPSTELFIYEIFQNAIYSDFQLDYNKNKFLPISDIIR
DTDDVIVYIVPHNPAVDIIVPVFNAVEDADSSYQMVNFFGIPLFVVMNKEVDVNSFGFIR
KKLLETASLLSKIDLVEEYEKIKKSCQGYVEKEFYKKSDFPALPQSLEGTDYNDNDEGYD
SEVSLANPYLGANFGFKIMYVHDYSPKLNSSLRNRYNFNQTNKFKQAERIINVPTHKPTF
SDFKPLSDQLSESKRNYYFYPDYKKMDDEMDQLVDEVNENLAEQEEARSSGSDNSSRASE
EQDGFVLINKEETLKQQSAVPAEMVPPPLPVRNNNGGHIPSSDEETESEANLGSLFDSTS
NLPLPPPSTYSESTKPSNVNSPMESNFESSSAELNSTTLISKDTVLLCDWDKEIFQRCFG
DKELQAWENISNLPNPELEKNRAHFERQRKAKITLSDCLKSFSTPEILGEHDLWYCPRCT
EHKRATKTIQLWSTGDILTIHLKRFHSARAFSDKIDVLVDFPIEELDISSYVANTDLKAE
DCLYDLIAVDNHYGGLGGGHYTASVKNFRDDKWYYFNDSRVTEINNPEEVVANSAYLLFY
RRRSSRGSGILGGKNFIELLQKGREEYSETLQKKRLALQDVGQMVNAYAKIEQDIIDEEA
EKQKEEQEQEQEENETVKKSRPFDDLKPSTTETNTSQQTTQFNFDDEDNDYDYEAEVEDS
NIRKQRLLSKENNSNKLVHIKSNGRQEVTSSPVPIETDGEIDATDSNSG
NT seq 3930 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaatatagaagatcgatccaaaataccttctgatgcgaaggaaattgtgact
acaaatgagattgaagcaacagattcagaacacacaacaaatgtcgataacgaactccgt
cataacgaatcaaatgaacgaacagaagagtaccacaacgataatcttgcatcaaaacgt
caattgattaatgatttattacataatgatgttattaaggaaggaactgaacgttatatt
attccacaagattttttgcatgaatttttgaatttaccaatcgataattttagtgatttg
aaggaaaagcttggtcctattgatttccacttagtagtcgatcagcaaggtattttatac
cctgagaacgaggaaccggtcccttcctgtcatgtatcgaccaaagtatttgagtatctt
ggtgaatggtttggaatattgggccaaccaattattagagctattattatcaatccagaa
accaaagaaaaagagattgaaagaaacactcccctattttgggtttaccaactaggcaaa
aagactcaaccgacatacttgcgacaccgtcataatggaagcagccatggtcatcatcat
ggacaccatgattcaccaataccagtgtctctttcgaaaacaagcactttttataattta
atggatttgatccgttataatgttcttaaggcaccgcgcaaatcgatgaaagattataga
atttggtttattattcctcaagacaaagatttacagtatttgatttcagtacaaactttt
atgtttgatatttcccaaaaaaccctagtttcaccaaatatgcttgatgatgccttgaag
aatcaaggtatcatggctaacacctatcatataatggtggagacaaaagaaaaacatcag
acagaattccccactgatcaattcattttgtctcattcgaacgcatacgaagaagtagca
caaggtggtggacaccttggattatcaaacatggggaacacttgttatatgaactcggct
ttgcaatgtctattacatgttcctgagattaactattatttcttctacaacatttacaag
aaagaattgaatttcgacaaccccttgggttatcatggtgatgttgccaatgcatttgga
tcccttttaaaacaggcttttgatcacgtgaagaatgggtctagtatttcacctagagaa
ttcaaatcaactatcgggagatactcctccatgttttctgggtatcttcaacaagattca
caagagctattgagttggttgttagatgctcttcatgaggatttgaatagaatccacaaa
aaaccttattgcgaaaagcctgaattaaaagatgacgaaatagatgatcctcaagcgata
aacaaattagccaatacttgttggaaccaacataaggcaagaaacgactcggtgataatc
gatttatttactgggttgtatcaatctacattaatctgtcctgattgcggtaagaaatcc
ataacttttgatccctttaatgacttgactttacctctaccgatcagtaagaaatggtat
cacacattcactattgtggatttgtccaacgaaggtgttatacctgaaaggataatgaag
ttggaagttgagttgaataagacgtctaattttgatgatttacttggttacctaagtaat
ttcttgaatattccatctacagaattgtttatttacgagatctttcaaaatgcaatctat
tctgacttccaattagattacaacaagaacaaatttttacccatcagcgatatcatcaga
gatacagatgatgttatagtatacattgttccacataaccctgcagttgatatcattgtg
ccggttttcaatgctgttgaggatgctgatagttcatatcaaatggttaatttttttgga
atacctttatttgtggtgatgaataaagaggtagatgtgaacagttttggttttatcaga
aagaaattgttagaaacagcttctctattgagcaagattgacttggtcgaggaatatgaa
aagatcaaaaagagttgtcaaggttatgttgagaaagagttttacaagaaactggatttc
cctgcattgccacaatcattagaaggtacggactataatgacaacgacgaaggctatgat
agtgaagtgtcgttggctaacccataccttggtgctaattttgggttcaaaatcatgtat
gtccatgactatagccctaaattaaattcatcccttcgtaacaggtacaattttaaccaa
acaaataaattcaaacaagcagagagaatcattaatgttcctacacacaaaccaactttt
agtgatttcaagcctttatcggaccaattatcagaatcaaagcgcaactactatttttat
ccagattataaaaaaatggatgatgaaatggatcaattggtcgatgaagtcaacgaaaat
ttggcagagcaagaagaagccagatcatcaggatcagataatagtagcagggcactggaa
gaacaagatggatttgtactaataaataaagaggaaactcttaagcagcaatcagccgta
cccgctgaaatggtgccaccaccattacctgttagaaataataatggagggcacattcct
tcatccgatgaagaaacagaaagtgaagccaatttaggaagcttgtttgattcaacatca
aacttaccgttacctccaccatctacatattcggaatccacaaaaccttcgaatgtaaac
tcgcctatggaaagcaactttgaaagttcatcagcagagttgaattctactacattgata
tcgaaggacactgttttattatgtgattgggataaagaaattttccaacgctgctttgga
gacaaggaattacaagcatgggaaaatatatcgaatttaccaaatccagaattggaaaaa
aatagagctcattttgaaagacaaagaaaagctaagatcacattatctgattgtcttaaa
agttttagcacaccagagattttaggggagcatgatttatggtattgtccacgttgtaca
gaacacaaacgtgcaacaaagacaatccagctttggtcaactggagatattctcactatt
catttgaaaagatttcatagtgctcgggcatttagtgataagattgatgttttagttgat
ttcccaattgaagagttagatataagttcgtatgttgctaatactgacttgaaggctgaa
gattgtttgtacgatttgattgcagttgacaatcattatggtggattaggaggtggtcat
tacaccgcttctgtaaagaactttagagacgataaatggtattattttaatgacagtcgg
gttactgagattaataatcctgaagaagtcgttgcaaactctgcataccttttattctac
cgccgaagaagttcaagaggatctggtattttgggagggaaaaactttattgaattactt
caaaaaggtagagaagagtactctgagactttacagaagaaaagactagctctccaagat
gttggccaaatggttaacgcctatgccaaaattgaacaagatataattgatgaagaagca
gagaaacagaaagaggaacaagaacaggaacaggaagagaatgaaacagtgaaaaaatca
aggccatttgatgatctcaaaccatcaactactgaaaccaatacctctcaacaaaccact
cagttcaactttgatgatgaagataatgattatgactatgaagcagaagtagaagattcc
aatatccgcaaacaaagattgctttcaaaagaaaataacagcaataagttggtacatatc
aagagcaacggtcgccaagaagtcacttcgtcaccagtaccaattgaaactgatggtgaa
attgatgccactgattctaattctggataa

DBGET integrated database retrieval system