KEGG   Candida dubliniensis: CD36_07550Help
Entry
CD36_07550        CDS       T01140                                 

Definition
(RefSeq) profilin, putative
  KO
K05759  
profilin
Organism
cdu  Candida dubliniensis
Brite
Membrane trafficking [BR:cdu04131]
 Others
  Actin-binding proteins
   Others
    CD36_07550
Cytoskeleton proteins [BR:cdu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     CD36_07550
Exosome [BR:cdu04147]
 Exosomal proteins
  Proteins found in most exosomes
   CD36_07550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1:1788537..1788917
Genome map
AA seq 126 aa AA seqDB search
MSWQAYTDNLIANGKVDKAALYSRAGDALWAQSGSFELQQPEITEIAKGFDSAEGLQTSG
LHVQGQKYFLLRADDRSIYGKHEAEGVICVRTKQTILIAHYPSGVQPGEATTLVEKLADY
LINAGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaagcctacactgataacttaattgctaacggtaaagtcgataaagcagcc
ttatattcaagagctggtgacgcattatgggcccaatccggatcattcgaattacaacaa
ccagaaattactgaaatcgccaaaggttttgatagtgctgaaggtttacagaccagtggt
ttacatgttcagggccaaaaatactttttgttaagagctgacgacagatcaatttacggt
aaacacgaagccgagggtgttatttgtgttagaactaaacaaactattttgatcgcccat
tatccgagtggtgttcaaccaggcgaagctaccactcttgttgaaaaattggccgattac
ttgatcaatgctggttattag

DBGET integrated database retrieval system