KEGG   Candida dubliniensis: CD36_07850Help
Entry
CD36_07850        CDS       T01140                                 

Definition
40 kDa allergen, putative (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cdu  Candida dubliniensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:cdu01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cdu00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:cdu00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:cdu00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1869618..1870664)
Genome map
AA seq 348 aa AA seqDB search
MSIPTTQKAVVFETNGGKLEYKDIPVPKPKPNELLINVKYSGVCHTDLHAWKGDWPLATK
LPLVGGHEGAGVVVALGENVKGWKVGDFAGIKWLNGSCLNCEYCQAGAEPNCAQADLSGY
THDGSFQQYATADAVQAARIPAGTDLANVAPILCAGVTVYKALKTADLQAGQWVAISGAA
GGLGSLAVQYAKAMGYRVLAIDGGEDKGEFVKSLGAEAYIDFTKEKDIVAAVKKATDGGP
HGVINVSVSEKAIDQSVEYVRSLGKVVLVGLPAHAKVSAPVFDSVVKSIQIKGSYVGNRK
DTAEAVDFFSRGLIKCPIKIVGLSELPEVYKLMEEGKILGRYVLDTTK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatcccaactactcaaaaagctgttgtttttgaaaccaacggaggtaaattggaa
tacaaagatatcccagtcccaaaaccaaagccaaatgaattattaattaatgttaaatac
tccggtgtctgtcacactgatttacacgcttggaaaggtgattggccattggctaccaaa
ttgccattggtcggtggtcacgaaggtgctggtgttgttgttgccttgggtgaaaatgtc
aaaggctggaaagttggtgattttgctggtatcaaatggttgaatggttcttgtttgaac
tgtgaatactgtcaagctggtgccgaaccaaattgtgctcaagctgatttatccggttac
acccacgatggttctttccaacaatatgctactgctgatgccgttcaagctgccagaatc
ccagctggtactgacttggccaatgttgctccaatattgtgtgctggtgtcactgtttac
aaagctttaaagactgctgacttgcaagctggtcaatgggtcgctatctctggtgccgct
ggtggtttgggttctttagctgtccaatatgccaaggctatgggttacagagttcttgcc
atcgatggtggtgaagacaaaggtgaattcgtcaaatcattaggtgctgaagcttacatt
gatttcaccaaagaaaaagatattgttgcagctgtcaagaaagccactgacggtggtcca
catggtgttatcaatgtctccgtttctgaaaaagctatcgaccaatctgttgaatacgtt
agatcattaggtaaagttgttttggttggtttgccagcacacgctaaagtttctgctcca
gtttttgattctgttgtcaaatctattcaaatcaaaggttcatacgttggtaacagaaaa
gacactgctgaagccgttgacttcttctcaagaggtttgatcaaatgtccaatcaagatt
gttggtttatctgaattaccagaagtttacaaattgatggaagaaggtaagattttgggt
agatacgtcttggacaccaccaaataa

DBGET integrated database retrieval system