KEGG   Candida dubliniensis: CD36_07870Help
Entry
CD36_07870        CDS       T01140                                 

Definition
fatty acid desaturase, putative (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cdu  Candida dubliniensis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CD36_07870
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CD36_07870
Enzymes [BR:cdu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CD36_07870
Lipid biosynthesis proteins [BR:cdu01004]
 Desaturase
  First
   CD36_07870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1874588..1876048)
Genome map
AA seq 486 aa AA seqDB search
MTTVEQLETVDITKLNAIAAGTNKKVPRVVAAGLGGRLMGTSDLVKVTAEEITKDSMESL
AEKDAREKAKYANRKHISEEPWTLSNFFQKINWLNMVLVVFIPAFGAYCAWYYPPQLKTI
VLAFVMYAFSGVSITAGYHRLYSHKSYDAALPVRLFFAFFGAGAIEGSIKWWGHSHRIHH
RYTDTSRDPYDARRGFWFSHMGWMLTKANPKNRARADISDLVADWVVTFQHRHYLLIMVA
AAFVFPTLVAGLGWGDYWGGFIYAGILKCFAIQQATFCVNSLAHWIGVQPFDDRRTPRDH
VLTAFVTFGEGYHNFHHEFPSDYRNALKWYQYDPTKVTIWCLSKLGLAWNLKKFSQNAIE
QGLVQQQQKKLDRMKAKLNWGAEIEKLPVWTREEFNERAKQEGLIIISGIIHNVKDFIKE
HPGGQALVRASLGKDATKAFNGAVYAHSNAAHNLLATMRVAVVKDGDVHADTFDLQQQMM
EKEKQS
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgactacagttgaacaacttgaaactgttgatatcactaaattgaatgccattgccgct
ggtactaataagaaagtgcccagagtggtggctgctgggttaggtggtagattaatgggt
acctccgatttagtcaaagtcactgctgaagaaatcaccaaggattcaatggaatcattg
gcagaaaaggatgccagagaaaaggcaaaatacgccaacagaaagcacatttcagaagag
ccatggactttaagcaattttttccaaaaaataaattggcttaatatggttttggttgtt
ttcatccctgcatttggagcttactgtgcgtggtattacccaccacaattgaagactata
gtgttggcatttgtcatgtatgcattcagtggtgtttcaattactgctggttatcatcgt
ttgtattctcataaatcatatgatgccgctttgccagtgagacttttctttgccttcttc
ggtgctggtgccattgaaggttcaataaaatggtggggtcattctcaccgtattcaccac
agatacaccgatacttcgagagacccatacgatgcccgaagagggttctggttttcccac
atgggatggatgttgactaaagccaaccctaaaaacagagctagagccgatatttccgac
cttgttgccgactgggttgtcaccttccaacacagacattatttgttgatcatggttgca
gctgcatttgttttcccaactttggttgctgggttaggttggggtgactattggggagga
ttcatttatgctggtattttgaaatgttttgccatccaacaagccactttctgtgtcaac
tctttggcccattggattggtgtccaaccttttgacgatagaagaactccacgtgatcac
gtgttgacggcatttgtgacatttggtgaaggttaccataacttccatcatgagttccct
agtgattacagaaatgctttgaagtggtaccagtacgatccaaccaaggtcaccatttgg
tgtttatctaaacttgggttggcttggaacttgaagaagttttcccagaatgccattgaa
caaggcttagtccagcaacaacaaaagaagcttgatagaatgaaggctaaattgaactgg
ggtgcagaaattgagaaattgcctgtgtggactagagaagaattcaacgaaagagctaaa
caggaaggattgattataatttctggtataattcacaatgttaaggacttcattaaagaa
caccccggtggtcaagctcttgttagggcttctttgggtaaagacgccacaaaggctttc
aacggtgctgtgtatgctcattcgaacgctgctcacaacttgttggcaaccatgagagtt
gctgtggttaaagatggtgacgttcatgccgatacctttgatttacaacaacaaatgatg
gagaaagaaaaacaatcttag

DBGET integrated database retrieval system