KEGG   Candida dubliniensis: CD36_08280Help
Entry
CD36_08280        CDS       T01140                                 

Definition
(repressible) alkaline phosphatase precursor, putative (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cdu  Candida dubliniensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CD36_08280
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CD36_08280
Exosome [BR:cdu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CD36_08280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1951793..1953448
Genome map
AA seq 551 aa AA seqDB search
MGLSNDQRPLLGGDSLTCWNKKQSGIKRNLSYLLNIITIAIIAYLCIFAKHSDSDENTGP
SLNPHKKKNIIMMVTDGMGPASLSAARSFRQFRDKLAINDILTLDKYLIGSSRTRSSSSL
VTDSAAGATAFSCALKSYNGAIGVTPDKTPCGTVLEALKLQGYYTGLVVTTRITDATPAA
FSSHVDYRFQEDLIAEHQLGEYPFGRAVDLILGGGRCHFLPTSEGGCRADKRNLIKEYSD
KWQYVGDRVSFDQLQGGKNVSLPLLGLLANTDIPYDIERKNSEYPSLAEQVQVALTALSE
ATKDSEQGFFLLIEGSRIDHASHHNDPAAHVREVLAYDKAFAEVIKFIDNTETETVAIST
SDHETGGLVVARQVSKSYPDYLWYPEVLLNSTHSGDYLSHKVAAYKEKDNTKKFTNFIKH
EILEKDLGISDYTANDVDLIIQNANNAGELLYILNNIVSIRAQIGWTTHGHSAVDVNIYA
HTNSPAIKSKLLSHKAYDGLSGNHENIEIGAFIESITGSNLNQVTQLIKETEHSPAQNNA
KVDDVYHANVL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgggtttgtcgaacgatcagagaccattacttggaggggatagtttaacatgttggaac
aagaaacaatctggcattaaaagaaatttgtcttacttgctcaatattataaccattgct
atcattgcatatttgtgcatatttgcaaaacactctgatagcgatgaaaatactggacca
tcattgaatcctcataagaaaaagaatattatcatgatggtgaccgatggtatgggacca
gcaagtttatccgccgctagatcatttagacaatttagagacaaattagccatcaatgat
attttgactcttgataaatatcttattggttcttctcgtacaagatcttcgagcagttta
gttacggactctgctgctggtgctaccgcgttttcttgtgctttgaaatcatacaacggt
gcaattggtgtaacaccagacaaaactccgtgtggtactgttttagaagccttaaaacta
caaggttactacactggtttagtggtcactactagaataaccgatgccacccctgctgca
tttagttcccacgttgattacagatttcaggaagatttgattgctgaacatcaattaggt
gaatacccatttggaagagcagtagatcttattttaggtggaggaagatgccacttttta
ccaacttcggaaggtggctgtcgtgccgataaaagaaatttgattaaagagtacagtgat
aaatggcagtatgtcggtgatagagtgctgtttgatcaattacagggagggaaaaacgtg
tcgttgccattattgggtttgttagcaaacacagacatcccctatgatattgaacgtaag
aattcagaatacccgtcattagctgaacaagttcaagttgcattaacagctttatcagag
gccaccaaggactcagaacaagggttctttttgttgattgaaggctctagaattgaccat
gcatcacatcataatgatcctgccgcacatgtaagagaggttttagcttatgacaaagca
tttgccgaagtcattaaatttatcgacaacaccgagaccgaaacagttgcaatttcaacc
agtgaccatgaaactggtggtttagttgttgccagacaagtttctaagctgtatccagat
tatttgtggtatccggaagtgttattaaatagtacgcattcaggggactacttgtctcac
aaggtggcagcttacaaagagaaagacaatactaagaagttcacaaattttatcaaacat
gaaatcttagaaaaagatttgggtatcagtgactacacagctaatgacgtcgatttaata
atccaaaacgcaaacaatgctggagagttactttacatattgaataatattgtttcaatc
agagctcaaattggatggactactcatggccactctgccgtagatgtcaacatttatgct
cacacaaactctcctgcaattaagtcgaaattgttatcacacaaagcttatgacggatta
tctgggaatcacgagaatattgaaataggagcattcattgagtctatcactgggtcaaat
ttgaaccaagtaacccaattgatcaaggaaacagagcattctccagcccagaataatgca
aaagtggatgacgtctaccatgccaatgtattgtaa

DBGET integrated database retrieval system