KEGG   Candida dubliniensis: CD36_08380Help
Entry
CD36_08380        CDS       T01140                                 

Definition
protoporphyrinogen oxidase, putative (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cdu  Candida dubliniensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CD36_08380
Enzymes [BR:cdu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CD36_08380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1971347..1972942
Genome map
AA seq 531 aa AA seqDB search
MTLITLPQNAKVAVLGAGISGLTFTYFLSKLRPDLQFTVFEKSTRPGGWMSSPKLHVNNT
NESILFEKGPRTLRGVKDGTLLMLDILRKLDLDSQIEVINEKCEANKKYVLDSSGEIIQV
PNSIGTTIEFLKNVKCVDRKLITGILKEPFVKPIKEDETIEQFFKRRLGSTVLTDNVASS
IIHGIYAGDVGKLSIKSIMSFMKDIENQSGSIVKHIFKSLYSTQNKKQEQLSQELQTYQQ
LISPNSELLTLQKTLKRYPMIKLHDGMETLPKYLAQYLINNTNTQIKYNTSIQDIDAVTG
KVNGESYDHIRSTINTHDLAKTLPTTDPLVPELKSIEYVSIFLTNVYSRSSNLIPKGKSG
FGFLSPRYRNVWKNPDALLGTIYDSDIENNVEGLFVDTKPVHNPNNKITIMMGGHYYTNW
SIPSNSVNLKIVKDILTSKLKVDLSKFNIKVIKDGEPLQIDEINDNDLVISYNFHSDCIP
QYNLGYQETKDKVNQILDQGYKLSFGGTVFADGVGVPDCVLNGFKDALKLK
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgactttaataactctacctcaaaatgcaaaagtggcagttttaggagcaggaattctg
ggattgacattcacgtatttcctttccaagctacgtccagatttacaattcactgtattt
gaaaaactgacaagacctggtggctggatgtcatctcctaaattacatgtcaacaatacc
aatgaatcaattctttttgaaaagggaccaagaactttacgtggagttaaagatgggact
ttattaatgcttgatattttgaggaaattagatttggattctcaaatagaagtaattaat
gaaaaatgtgaggccaataagaaatacgttcttgattcttctggagaaatcattcaagtt
cctaattcaattggtacaacaattgaatttcttaaaaatgtgaaatgtgtggataggaaa
ctaataactggaatattaaaagaaccatttgttaaaccaataaaagaagatgaaacaatt
gaacaatttttcaaaagaagattaggcagtactgtacttacagacaatgttgccagttct
attattcatgggatatatgctggtgatgttgggaaattaagtattaaaagtattatgtca
tttatgaaagatattgaaaatcaatcgggatcaatagtcaaacatattttcaaatccctt
tattcaacacaaaataagaaacaggagcagttgtctcaagaattacaaacatatcagcag
ttaatatctccaaattcagaattattgactctacaaaaaacattgaaacgataccccatg
atcaaattacatgatggaatggaaacattacctaaatatttagcacaatatttaatcaac
aacactaacacccagattaaatacaatacttctatacaagatatagatgccgtgacaggg
aaagtcaatggtgaatcatatgatcatatccgatccactatcaatacccatgatttagcg
aaaacattaccaacaactgatccattagtaccagaattgaaatccattgaatatgtgagt
atttttttaaccaatgtttattcaagatcttcaaatttgattcctaaaggtaaatctggg
tttggatttttatcgccacgatacagaaatgtttggaagaatcctgatgcattattagga
acaatttatgattctgatatcgaaaataatgttgaaggactctttgttgatactaaacca
gttcataatcccaataataaaataactattatgatgggtggtcattattatacaaattgg
tcaattccttcaaattcagtaaatttgaaaattgttaaagatatattgacatcaaaatta
aaagttgatttatcaaaattcaatataaaagtgattaaagatggtgaacctttacaaata
gatgaaattaatgataatgatcttgtaatttcatataatttccattcagattgtattcct
caatataatttaggttatcaagaaacaaaagataaagtgaatcaaattcttgatcaaggt
tataagctctcatttggaggaacggtgtttgctgatggtgttggtgttcccgattgtgtg
ttaaacgggtttaaagatgccttgaaattgaaatag

DBGET integrated database retrieval system