KEGG   Candida dubliniensis: CD36_09130Help
Entry
CD36_09130        CDS       T01140                                 

Definition
malate synthase, putative
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
cdu  Candida dubliniensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CD36_09130
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CD36_09130
   00630 Glyoxylate and dicarboxylate metabolism
    CD36_09130
Enzymes [BR:cdu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CD36_09130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2171758..2173413
Genome map
AA seq 551 aa AA seqDB search
MSSPFPKTADKVKGVQILGPVPESAKHIFNQETLAFVATLHRGFEARRQELLNNRKEQQK
LRDQGFLPDFLPETEYIRNDPTWTGPSLAPGLVDRRCEITGPTDRKMVINALNSNVATYM
ADFEDSLTPAWKNLVEGQVNLYDGVRRNLTASINGKKYALNLEKGRHIPTLIVRPRGWHL
DEKHVLVDGKPVSGGIFDFAVYFYNNAQETLARGFGPYFYLPKMEHHLEAKLWNDIFNYA
QDYIGLRRGTIRASVLIETIPAVFQMDEIIYQLREHSAGLNCGRWDYIFSYIKCLRNHPD
FILPDRSQVTMAAPFMSSYVKLLVHTTHKRKVHALGGMAAQIPIKDDEERNRAALANVTK
DKLREVTLGCDSCWVAHPALVPVVLKVFNENMKGPNQISLPPKEPFKPITQRDLLSPFVP
NAKITEQGIRANIIIGISYIEAWLRNVGCVPINYLMEDAATAEVSRTQIWQWVTHGAKTD
TGKVIDKQYVKQLLDEEYAKLVKSAKPGNKFKRAFEYFAPEALGEKYSDFVTTLIYDDVT
TIGRSLPGERL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccccattcccaaaaacagctgataaggtcaaaggtgtccaaatattaggtcca
gttccagaaagtgctaaacacattttcaaccaggaaactttagcattcgttgccacttta
caccgtggttttgaagccagaagacaagaattgttgaacaacagaaaagaacaacaaaag
ttaagagaccaaggtttcttaccagacttcttaccagaaactgaatatattagaaatgat
cctacctggactggtccatcattggctccaggtttggttgacagaagatgtgaaatcact
ggtccaaccgacagaaagatggtcatcaacgccttgaactccaacgttgctacatacatg
gctgattttgaagattcgttgaccccagcttggaaaaacttggttgaaggtcaagtcaat
ctttacgatggtgtcagaagaaacttgactgccagcatcaatggtaagaaatatgccttg
aacttggaaaaaggcagacacattccaaccttgattgtgagaccaagaggatggcacttg
gatgaaaaacacgttttggttgatggtaagccagtttccggtggtatttttgattttgct
gtctacttctacaacaatgctcaagaaactttagctagaggctttggtccatacttctat
ttgccaaagatggaacaccacttggaagcaaaattatggaacgatattttcaactacgcc
caagactacattgggttgagaagaggtaccatcagagcttcagttttgatcgaaaccatt
ccagctgttttccaaatggatgaaatcatctatcaattaagagaacacagtgctggtttg
aactgtggtagatgggattatattttctcctacatcaagtgtttaagaaaccacccagac
tttattttgccagatagatcacaagtcacaatggcagctccattcatgtcctcctatgtt
aagttattggtccacactacccataagagaaaagtccacgctcttggtggtatggctgct
caaattccaatcaaggacgatgaagaaagaaacagagctgctttggccaatgtcactaaa
gataaattaagagaagttactcttggatgtgattcatgttgggttgcccacccagctttg
gttccagttgtgttgaaagttttcaacgaaaacatgaagggtccaaaccaaatctcattg
ccaccaaaggaaccattcaagccaatcacccaaagagacttgttgagtccatttgttcca
aatgctaaaattactgaacaaggtattagagcaaatatcattattggtatctcctacatt
gaggcttggttaagaaatgtcggttgtgttccaatcaactatttgatggaagatgccgct
accgctgaggtttccagaactcaaatttggcaatgggttacacatggtgctaagactgac
actggtaaagttattgacaagcaatacgttaagcaattattggatgaagaatatgctaaa
ttggtcaagagtgctaaaccaggtaacaagttcaagagagctttcgaatactttgctcca
gaagctcttggtgaaaagtactctgactttgtaacaactttgatttacgacgatgtcact
actattggcagatctttaccaggtgaaagattgtaa

DBGET integrated database retrieval system