KEGG   Candida dubliniensis: CD36_09610Help
Entry
CD36_09610        CDS       T01140                                 

Definition
(RefSeq) cAMP-dependent protei kinase catalytic subunit, putative
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
cdu  Candida dubliniensis
Pathway
cdu04113  Meiosis - yeast
cdu04138  Autophagy - yeast
cdu04213  Longevity regulating pathway - multiple species
Module
cdu_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Cellular Processes
  Transport and catabolism
   04138 Autophagy - yeast
    CD36_09610
  Cell growth and death
   04113 Meiosis - yeast
    CD36_09610
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    CD36_09610
Enzymes [BR:cdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CD36_09610
Protein kinases [BR:cdu01001]
 Serine/threonine kinases: AGC group
  PKA family
   CD36_09610
Messenger RNA biogenesis [BR:cdu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CD36_09610
Chromosome and associated proteins [BR:cdu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    CD36_09610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 8045152
NCBI-ProteinID: XP_002417605
UniProt: B9W936
Position
1:complement(2300386..2301615)
Genome map
AA seq 409 aa AA seqDB search
MTSMEPADTSIRSLNDINLQELANKQHQRNIYAQGSPTLEDSLTSNGNDINNPNNNINKS
TTNTNNNSSSSLSLTKKTSRHINKDTTTKGKYTLNDFQILRTLGTGSFGRVHLTRSIHNG
RFYAMKVLKKQRVVQMKQIEHTNDERRMLKLAQHPFIIRMWGTFQDCHNLFMIMDYIEGG
ELFSLLRKSQRFPTPVAKFYAAEVFLAIEYLHSLDIIYRDLKPENILLDKNGHIKLTDFG
FAKEVQDVTYTLCGTPDYIAPEVVATKPYNKSVDWWSFGILIFEMLTGYTPFYDPTPMKT
YENILNGSITYPDYLPPDILDLLQKLIVKDLTQRLGNLQGGSDDVKNHPWFKEVIWERLL
SRDIETPYEPPITSGVGDTSQFDRYPEDKDLDYGISGVEDPYRDQFSDF
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgacatctatggaaccagcagataccagtattaggtcgttaaacgatatcaatttacaa
gaacttgccaacaaacaacatcaacgaaatatatatgctcaagggtcacctacactagaa
gattccctaacatcaaatggcaatgatattaataacccaaacaacaatataaacaaatcc
accaccaacaccaataataatagtagttcaagtctttcattgactaaaaagacatcgaga
catattaacaaagacactacaaccaaaggcaaatatacattaaatgattttcaaatatta
cgaactttgggaacaggttcctttggtagagttcatttaactcgatcgattcataatggt
agattttatgctatgaaagtattaaagaaacaaagagtagtacaaatgaaacaaatagaa
catactaatgatgaaagaagaatgttaaaattagctcaacatccatttataattcgaatg
tgggggacatttcaagattgtcataacttatttatgattatggattatatagaaggagga
gaactattttcattattaagaaaatcacaacgatttcctactccagtagctaaattttat
gctgcagaagtatttttagctattgaatatttacacagtttagacatcatttatcgagat
ttaaaaccagaaaatatattattagataaaaatggtcatatcaaattaactgattttggt
tttgctaaagaagttcaagatgtaacttatactttatgtggaactcctgattatatagct
ccagaagtggtggcaacaaaaccttataataaatcagttgattggtggtcatttggaata
ttaatatttgaaatgttaactggttatactcccttctatgatccaactccaatgaaaact
tatgaaaacattttaaatggttcaattacttatccagattatttgcctccagatatattg
gatcttctacaaaaattaattgttaaagatttgactcaaagattaggtaatttacaaggt
ggatccgatgatgtgaaaaatcatccctggtttaaagaagtcatttgggaaagattattg
tcacgtgatatagaaactccatatgaacctcctataacctctggagttggagatacttca
caatttgatcgatatcctgaagataaagatttggattatggtataagtggagttgaagac
ccatatcgtgatcaattcctggacttttaa

DBGET integrated database retrieval system