KEGG   Candida dubliniensis: CD36_09610Help
Entry
CD36_09610        CDS       T01140                                 

Definition
(RefSeq) cAMP-dependent protei kinase catalytic subunit, putative
Organism
cdu  Candida dubliniensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2300386..2301615)
Genome map
AA seq 409 aa AA seqDB search
MTSMEPADTSIRSLNDINLQELANKQHQRNIYAQGSPTLEDSLTSNGNDINNPNNNINKS
TTNTNNNSSSSLSLTKKTSRHINKDTTTKGKYTLNDFQILRTLGTGSFGRVHLTRSIHNG
RFYAMKVLKKQRVVQMKQIEHTNDERRMLKLAQHPFIIRMWGTFQDCHNLFMIMDYIEGG
ELFSLLRKSQRFPTPVAKFYAAEVFLAIEYLHSLDIIYRDLKPENILLDKNGHIKLTDFG
FAKEVQDVTYTLCGTPDYIAPEVVATKPYNKSVDWWSFGILIFEMLTGYTPFYDPTPMKT
YENILNGSITYPDYLPPDILDLLQKLIVKDLTQRLGNLQGGSDDVKNHPWFKEVIWERLL
SRDIETPYEPPITSGVGDTSQFDRYPEDKDLDYGISGVEDPYRDQFSDF
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgacatctatggaaccagcagataccagtattaggtcgttaaacgatatcaatttacaa
gaacttgccaacaaacaacatcaacgaaatatatatgctcaagggtcacctacactagaa
gattccctaacatcaaatggcaatgatattaataacccaaacaacaatataaacaaatcc
accaccaacaccaataataatagtagttcaagtctttcattgactaaaaagacatcgaga
catattaacaaagacactacaaccaaaggcaaatatacattaaatgattttcaaatatta
cgaactttgggaacaggttcctttggtagagttcatttaactcgatcgattcataatggt
agattttatgctatgaaagtattaaagaaacaaagagtagtacaaatgaaacaaatagaa
catactaatgatgaaagaagaatgttaaaattagctcaacatccatttataattcgaatg
tgggggacatttcaagattgtcataacttatttatgattatggattatatagaaggagga
gaactattttcattattaagaaaatcacaacgatttcctactccagtagctaaattttat
gctgcagaagtatttttagctattgaatatttacacagtttagacatcatttatcgagat
ttaaaaccagaaaatatattattagataaaaatggtcatatcaaattaactgattttggt
tttgctaaagaagttcaagatgtaacttatactttatgtggaactcctgattatatagct
ccagaagtggtggcaacaaaaccttataataaatcagttgattggtggtcatttggaata
ttaatatttgaaatgttaactggttatactcccttctatgatccaactccaatgaaaact
tatgaaaacattttaaatggttcaattacttatccagattatttgcctccagatatattg
gatcttctacaaaaattaattgttaaagatttgactcaaagattaggtaatttacaaggt
ggatccgatgatgtgaaaaatcatccctggtttaaagaagtcatttgggaaagattattg
tcacgtgatatagaaactccatatgaacctcctataacctctggagttggagatacttca
caatttgatcgatatcctgaagataaagatttggattatggtataagtggagttgaagac
ccatatcgtgatcaattcctggacttttaa

DBGET integrated database retrieval system