KEGG   Candida dubliniensis: CD36_09610Help
Entry
CD36_09610        CDS       T01140                                 

Definition
cAMP-dependent protei kinase catalytic subunit, putative
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cdu  Candida dubliniensis
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    CD36_09610
Enzymes [BR:cdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CD36_09610
Protein kinases [BR:cdu01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   CD36_09610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2300386..2301615)
Genome map
AA seq 409 aa AA seqDB search
MTSMEPADTSIRSLNDINLQELANKQHQRNIYAQGSPTLEDSLTSNGNDINNPNNNINKS
TTNTNNNSSSSLSLTKKTSRHINKDTTTKGKYTLNDFQILRTLGTGSFGRVHLTRSIHNG
RFYAMKVLKKQRVVQMKQIEHTNDERRMLKLAQHPFIIRMWGTFQDCHNLFMIMDYIEGG
ELFSLLRKSQRFPTPVAKFYAAEVFLAIEYLHSLDIIYRDLKPENILLDKNGHIKLTDFG
FAKEVQDVTYTLCGTPDYIAPEVVATKPYNKSVDWWSFGILIFEMLTGYTPFYDPTPMKT
YENILNGSITYPDYLPPDILDLLQKLIVKDLTQRLGNLQGGSDDVKNHPWFKEVIWERLL
SRDIETPYEPPITSGVGDTSQFDRYPEDKDLDYGISGVEDPYRDQFSDF
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgacatctatggaaccagcagataccagtattaggtcgttaaacgatatcaatttacaa
gaacttgccaacaaacaacatcaacgaaatatatatgctcaagggtcacctacactagaa
gattccctaacatcaaatggcaatgatattaataacccaaacaacaatataaacaaatcc
accaccaacaccaataataatagtagttcaagtctttcattgactaaaaagacatcgaga
catattaacaaagacactacaaccaaaggcaaatatacattaaatgattttcaaatatta
cgaactttgggaacaggttcctttggtagagttcatttaactcgatcgattcataatggt
agattttatgctatgaaagtattaaagaaacaaagagtagtacaaatgaaacaaatagaa
catactaatgatgaaagaagaatgttaaaattagctcaacatccatttataattcgaatg
tgggggacatttcaagattgtcataacttatttatgattatggattatatagaaggagga
gaactattttcattattaagaaaatcacaacgatttcctactccagtagctaaattttat
gctgcagaagtatttttagctattgaatatttacacagtttagacatcatttatcgagat
ttaaaaccagaaaatatattattagataaaaatggtcatatcaaattaactgattttggt
tttgctaaagaagttcaagatgtaacttatactttatgtggaactcctgattatatagct
ccagaagtggtggcaacaaaaccttataataaatcagttgattggtggtcatttggaata
ttaatatttgaaatgttaactggttatactcccttctatgatccaactccaatgaaaact
tatgaaaacattttaaatggttcaattacttatccagattatttgcctccagatatattg
gatcttctacaaaaattaattgttaaagatttgactcaaagattaggtaatttacaaggt
ggatccgatgatgtgaaaaatcatccctggtttaaagaagtcatttgggaaagattattg
tcacgtgatatagaaactccatatgaacctcctataacctctggagttggagatacttca
caatttgatcgatatcctgaagataaagatttggattatggtataagtggagttgaagac
ccatatcgtgatcaattcctggacttttaa

DBGET integrated database retrieval system