KEGG   Candida dubliniensis: CD36_11310Help
Entry
CD36_11310        CDS       T01140                                 

Definition
sphingoid long-chain base kinase, putative
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
cdu  Candida dubliniensis
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CD36_11310
Enzymes [BR:cdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     CD36_11310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2681804..2683396
Genome map
AA seq 530 aa AA seqDB search
MSSSSTPQATGLQMSDSIKSSTDRLLYRKNDIIGATLSSDNGIYLSGQSLQHLPKHEESI
FDTLSACYKSPDNTIESDFIPFKNILNVESITGSIADEDEVTNSNLLEITYTLPFSDLNH
DLKLEKIKIDIESGPEIPPSLAEFVLLQSYEKSIIRPSILVLINPHGGQGNAKTIYKDKI
LPVLQAAHANITYFETKYHGHATEIARELDVNDYDIIVCCSGDGIPHEVINGFYLRPDKG
VSAFNKIAVTQLPCGSGNALSLSTHGSKNASVATLHMLKAHKTKLDLMAITQGTGSEKIT
KLSFLSQCYGIIADSDIGTEHLRWLGPIRFELGVIQKVFSGAKYPCDLFVKYKYDNNSEI
LSHVNDYLTNNDNKNELPIITEKDLQITSPDLDQPVPNDWKRIPNEISHNLNILYVGKMP
FVSADTQFFPAALPNDGSMDMIVTDSNNSIWKLTSILMAVESGKHIDDEKVYHTKVLSYR
LIPNIKDDSKHYISIDGEDFPFEPFQVEILPGVLTGLLQDGNFVETSFTK
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcctcatctactcctcaagcgactggtttgcagatgagtgatagtatcaaatca
tcgacagatagattattataccgcaaaaatgatattatcggggccacattaagttcggat
aacggaatttatttatccggtcaatctttacaacaccttccaaaacatgaagaatcaatt
tttgatactttgagtgcttgttataaatcccctgacaacacaatagaatcagatttcatc
ccatttaaaaatatattaaacgtggaatcgattacaggcagtattgccgatgaagatgaa
gttaccaattccaatttattagagattacttatactttaccattcctggatttaaatcac
gacttgaagcttgaaaaaataaaaatcgatatagaaagcggtcccgaaatccccccttct
cttgctgaatttgtattattgcaatcatatgaaaaaagcattatccggccttccattttg
gtattgataaatcctcacggaggtcaaggaaatgccaaaactatttataaagataaaatt
ttgcctgtattacaagccgctcatgctaacattacgtattttgaaacaaaatatcacggg
cacgctacagagattgcacgagagttggatgtcaatgattatgatataattgtttgttgt
tctggagatgggatacctcatgaagttattaatggcttctatcttcggccagataaaggt
gtactggcattcaacaaaatcgctgttactcaattaccttgtgggtcagggaatgcattg
agtttgagtacacatggtagtaaaaatgcatcagttgcaactcttcatatgttgaaagct
cataagacaaaattagatttgatggctattactcaaggtacaggaagtgaaaagataaca
aaattatcttttttaagtcaatgttatggtattattgctgattctgatattggaaccgaa
catttacgttggttgggtcctataagatttgaacttggagtgatacaaaaagtgttttct
ggggcaaaatatccatgtgatttatttgtgaaatacaaatacgataacaattcagaaatc
ttaagtcatgtaaacgattacttgaccaataatgataataagaacgagctacctattatc
actgaaaaagacttacaaataacgagcccagatttggatcagcctgtgcctaatgattgg
aaacgtattcctaatgaaatttcccacaatttgaatatattatatgttggcaaaatgcca
ttcgtgtctgcagatactcaatttttcccagctgcgctaccgaatgacggttcaatggat
atgattgtcaccgattccaacaattctatatggaaattgacgtcgatattgatggcagtg
gaaagtgggaaacatattgatgatgaaaaagtgtaccatacaaaggttttaagttatcgt
ttgataccaaatatcaaagatgatagtaaacactatatatccattgatggtgaagatttc
ccatttgaacctttccaagttgaaatattaccaggagtgttgacaggattactacaggat
gggaactttgtggaaacatcatttaccaaatag

DBGET integrated database retrieval system