KEGG   Candida dubliniensis: CD36_11440Help
Entry
CD36_11440        CDS       T01140                                 

Definition
anthranilate synthase component II [Includes: Glutamine amidotransferase; Indole-3-glycerol phosphate synthase], putative (EC:4.1.3.27 4.1.1.48 5.3.1.24)
Orthology
K01656  
anthranilate synthase / indole-3-glycerol phosphate synthase [EC:4.1.3.27 4.1.1.48]
Organism
cdu  Candida dubliniensis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CD36_11440
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CD36_11440
Enzymes [BR:cdu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CD36_11440
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     CD36_11440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2705064..2706620
Genome map
AA seq 518 aa AA seqDB search
MTTADVSSKRHVLMIDNYDSFTWNLYQYLHQSPKCGKVDVYRNDKITISQIENEIKPDII
FISPGPGHPLTDSGVSREVIKYFSGKIPIFGVCMGQECIFDVFGGDVSYAGEIVHGKTTT
IKHDGKGMFEDVPQSVAVTRYHSLAGSSKSLPDVLEVTAVTETQPEVIMGVRHKKYTIEG
VQFHPESILTESGQLMIDNLLGVYGGTWEENDAFKTGKMINKTGGGNILQKIYKQRKIDY
ESIEKLPGKSFENLQIEFDLDLAPPLINFYDRLKYTQSSLKETIILSEFKRASPSKGDIN
INAHPANQALTYAINGCSTISVLTEPHWFKGSLDDLTLIRKVIDKPTTNDYKRPAVLRKE
FIFNKYQILESRLAGADTVLLIVKMLNDDTLLHELYQYSLDLGMVPLVEVNNSDELSQSL
KLTYKGSTEEPLIIGVNNRNLTTFDVDLNTTSNLVKQAKTSDRKGDVLVLALSGISSVDD
VKKYQYEDNVDGFLIGESLMRAEEKGEAGKFLHDLCTC
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgactactgctgatgtatcctcaaaaagacatgtgttaatgattgataattatgattca
tttacttggaatttatatcaatatttacatcaatctcctaaatgtggtaaagtagacgtt
tatagaaatgataaaatcaccatttctcaaattgaaaatgaaattaagccagatataatt
tttatttctccaggtccaggacaccctttgactgattctggtgtttcaagagaagtaatt
aagtatttcctgggtaaaatccctatttttggtgtttgtatgggacaagaatgtatattt
gatgtatttggaggtgatgtctcatatgctggggaaattgttcatgggaaaacaactact
ataaagcatgatggtaaaggtatgtttgaagatgtaccacaatcagttgctgtaactaga
tatcattcattagctggtagttctaaatcgttacctgatgtattagaagttactgccgtt
acggaaactcaaccagaagtgattatgggagttagacataaaaaatataccattgaagga
gttcaatttcatcctgaatcaattttaactgaaagtggacaattaatgattgataattta
ttaggagtttatggtggtacttgggaagaaaatgatgcatttaaaaccggtaaaatgatt
aacaaaactggaggcggtaatatattacaaaaaatttacaaacaaaggaaaatagattat
gaatcaattgaaaaattaccaggtaaatcatttgaaaatttacaaattgaatttgattta
gatcttgcaccaccattaataaatttctatgatcgtcttaaatatactcaatctagtttg
aaagaaaccattatattatcagaattcaaacgtgcaagtccttctaagggggatattaat
ataaatgctcatccagctaatcaagcattgacatatgctattaatggttgttccaccatt
tctgttttaactgaacctcattggtttaaaggatccttagatgatttaactttgatccgt
aaagtgattgacaaacctaccacaaacgattataaacgtccagcggtattgagaaaagaa
tttatttttaataagtatcaaattttagaaagtagattagctggtgctgatacagttttg
ttaattgttaaaatgttgaatgatgacacgttgttacatgaactatatcaatattctttg
gatttggggatggttccattggtagaagttaataatagtgatgaattatctcaatctttg
aaattgacttataagggttcaactgaagaaccattaattattggagttaataatcgtaac
ttgactacttttgatgttgatttgaataccacaagtaatttagtaaagcaagctaaaact
agtgatagaaaaggtgacgtgttggttcttgcattatccgggataagttcagtggatgat
gtaaagaagtaccagtatgaagataatgtagatggttttttgattggagagagtttaatg
agagctgaagaaaagggtgaagcaggtaagtttttgcatgatttatgtacttgctaa

DBGET integrated database retrieval system