KEGG   Candida dubliniensis: CD36_11440Help
Entry
CD36_11440        CDS       T01140                                 

Definition
anthranilate synthase component II [Includes: Glutamine amidotransferase; Indole-3-glycerol phosphate synthase], putative (EC:4.1.3.27 4.1.1.48 5.3.1.24)
Orthology
K01656  
anthranilate synthase / indole-3-glycerol phosphate synthase [EC:4.1.3.27 4.1.1.48]
Organism
cdu  Candida dubliniensis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cdu01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cdu00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2705064..2706620
Genome map
AA seq 518 aa AA seqDB search
MTTADVSSKRHVLMIDNYDSFTWNLYQYLHQSPKCGKVDVYRNDKITISQIENEIKPDII
FISPGPGHPLTDSGVSREVIKYFSGKIPIFGVCMGQECIFDVFGGDVSYAGEIVHGKTTT
IKHDGKGMFEDVPQSVAVTRYHSLAGSSKSLPDVLEVTAVTETQPEVIMGVRHKKYTIEG
VQFHPESILTESGQLMIDNLLGVYGGTWEENDAFKTGKMINKTGGGNILQKIYKQRKIDY
ESIEKLPGKSFENLQIEFDLDLAPPLINFYDRLKYTQSSLKETIILSEFKRASPSKGDIN
INAHPANQALTYAINGCSTISVLTEPHWFKGSLDDLTLIRKVIDKPTTNDYKRPAVLRKE
FIFNKYQILESRLAGADTVLLIVKMLNDDTLLHELYQYSLDLGMVPLVEVNNSDELSQSL
KLTYKGSTEEPLIIGVNNRNLTTFDVDLNTTSNLVKQAKTSDRKGDVLVLALSGISSVDD
VKKYQYEDNVDGFLIGESLMRAEEKGEAGKFLHDLCTC
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgactactgctgatgtatcctcaaaaagacatgtgttaatgattgataattatgattca
tttacttggaatttatatcaatatttacatcaatctcctaaatgtggtaaagtagacgtt
tatagaaatgataaaatcaccatttctcaaattgaaaatgaaattaagccagatataatt
tttatttctccaggtccaggacaccctttgactgattctggtgtttcaagagaagtaatt
aagtatttcctgggtaaaatccctatttttggtgtttgtatgggacaagaatgtatattt
gatgtatttggaggtgatgtctcatatgctggggaaattgttcatgggaaaacaactact
ataaagcatgatggtaaaggtatgtttgaagatgtaccacaatcagttgctgtaactaga
tatcattcattagctggtagttctaaatcgttacctgatgtattagaagttactgccgtt
acggaaactcaaccagaagtgattatgggagttagacataaaaaatataccattgaagga
gttcaatttcatcctgaatcaattttaactgaaagtggacaattaatgattgataattta
ttaggagtttatggtggtacttgggaagaaaatgatgcatttaaaaccggtaaaatgatt
aacaaaactggaggcggtaatatattacaaaaaatttacaaacaaaggaaaatagattat
gaatcaattgaaaaattaccaggtaaatcatttgaaaatttacaaattgaatttgattta
gatcttgcaccaccattaataaatttctatgatcgtcttaaatatactcaatctagtttg
aaagaaaccattatattatcagaattcaaacgtgcaagtccttctaagggggatattaat
ataaatgctcatccagctaatcaagcattgacatatgctattaatggttgttccaccatt
tctgttttaactgaacctcattggtttaaaggatccttagatgatttaactttgatccgt
aaagtgattgacaaacctaccacaaacgattataaacgtccagcggtattgagaaaagaa
tttatttttaataagtatcaaattttagaaagtagattagctggtgctgatacagttttg
ttaattgttaaaatgttgaatgatgacacgttgttacatgaactatatcaatattctttg
gatttggggatggttccattggtagaagttaataatagtgatgaattatctcaatctttg
aaattgacttataagggttcaactgaagaaccattaattattggagttaataatcgtaac
ttgactacttttgatgttgatttgaataccacaagtaatttagtaaagcaagctaaaact
agtgatagaaaaggtgacgtgttggttcttgcattatccgggataagttcagtggatgat
gtaaagaagtaccagtatgaagataatgtagatggttttttgattggagagagtttaatg
agagctgaagaaaagggtgaagcaggtaagtttttgcatgatttatgtacttgctaa

DBGET integrated database retrieval system