KEGG   Candida dubliniensis: CD36_11960Help
Entry
CD36_11960        CDS       T01140                                 

Definition
ribokinase, putative (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cdu  Candida dubliniensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CD36_11960
Enzymes [BR:cdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CD36_11960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2823339..2824469
Genome map
AA seq 376 aa AA seqDB search
MPSITIIGSLNYDLVTYTNKIPQGGETYQANSFETHVGGKGLYESIAVAKLTPPNSILMS
HNDCGSDKIDIRMVGKIGDDSFGQQLKQFLIDNKVNVDHVITVINQTSGVAIILVEQNNN
GENRILIIPGANGELKLDDKEYETIFSKNKGNDEFNSFVILQNEYPDTIKSINWIKKNRP
QLNIAYNPSPFKSELITKELLSKIDLLIVNEGEALDVANHLMKNSHQQDLIDQINHINRG
GSGDGGDNSKLLIEVFSKLAIELQQLINPHNVQVVIITMGSKGSIYIAKETNNNNNNNNN
NNNNNNPQFIEARKVEKVIDTTGAGDTFFGAIVSNLALGKSIDYAIKFATTASSLTIQKK
GAAEGIPSYQEVIDNL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgccatcaattactattattggatcattaaattatgatttagtaacatatactaataaa
atccctcaaggtggagaaacatatcaagcaaattcatttgaaactcatgttggaggtaaa
ggattatatgaatctattgctgttgccaaattaactccaccaaattctatcttaatgagt
cataatgattgtggtagtgataaaattgatattcgtatggtgggtaaaattggtgatgat
tcatttggtcaacaattgaaacaatttttaattgataataaagttaatgttgatcatgta
atcactgtgattaatcaaacttctggagtggcaattattttagttgaacaaaataataat
ggagaaaatcgaattttaataattcctggagctaatggggaattaaaacttgatgataaa
gaatatgaaaccattttctcaaaaaataaaggtaatgatgaatttaattcatttgtgatt
ttacaaaatgaatatcctgatactattaaatcaatcaattggattaaaaaaaatcgtcca
caattgaatattgcttataatccatcaccatttaaatcagaattaattactaaagaatta
ttatcgaaaatagatttattaatagttaatgaaggtgaagcattagatgtggctaatcat
ttaatgaaaaattctcatcaacaagatttaattgatcaaataaatcacatcaatcgtggt
ggtagtggtgatggtggtgataatagtaaattattgattgaagtgtttctgaaattggcc
attgaattacaacaattaattaatcctcataatgttcaagtggtaattataactatgggt
agtaaaggatccatttatattgctaaagaaaccaataataataataataataataataat
aataataataataataatccacaatttattgaagctagaaaagttgaaaaagtcattgat
actactggggctggtgatacattttttggagcaattgttctgaatttagcattaggtaaa
ctgattgattatgcaataaagtttgctactacagcaagcagtttaacaattcaaaagaaa
ggtgctgctgaaggaataccaagttatcaagaagtaatagacaacttgtaa

DBGET integrated database retrieval system