KEGG   Candida dubliniensis: CD36_12980Help
Entry
CD36_12980        CDS       T01140                                 

Definition
deubiquitinating enzyme 5, putative (EC:3.1.2.15)
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
cdu  Candida dubliniensis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CD36_12980
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CD36_12980
Peptidases [BR:cdu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CD36_12980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3117344..3119779)
Genome map
AA seq 811 aa AA seqDB search
MKDLVRSTSELDHISKTLVELLKKNHESFKSLFNVQLDLLKLFDKEVNNLESIGYCDYEV
AYVSYMIIIQLIAVMKTKSSPKTADIYNGIQQSIRKKASNFKMVLGYFKNDDDDKDDDPL
INRFKSLSGEKIHTSTTTKKELIYHEWITPAELETTLCEKHVLLIDYRLKKDYLHNHIKF
ENLINIEPRQIESLPQSATDSDLEEVLRKSLSEKEFQMFLDRNKFDFIIVYNYNYGSTSK
ERLYGIIDVLENENPFISLIGILMNNKYISSRLKIAPSFLSGGILNWYHTLGADYLETTS
TKNCDSSNEETRYLTSFSDYLSNSKESSPSEIKIVNGSSSAYIKPVQRKIEQFDHLPPKS
PATVYSSSKVELPLTPTSSIPNSPAPPSQSLPSNGKLPNNVTSKDITISSKKSQFLESYA
TGLVNLGNSCYMNCVIQCLAATPQLTSFFFPTITESFSDNSYKRHINVNNKLGTKGMLTT
SFVELILSMLNNNGRSFSPSKFKKIMGSLSPSRQFASFDQQDCIEFLNFLLDALHEDLNQ
VSIADPQERKMITELTPEQEKNREILPVRLASTIEWERYLKLNFSIIVDYFQGQYLSQLK
CLECGFTSTTYNAFSILSLPIPEKLNKSMKVSLDECLQEFVTTELLDDNNKWYCPNCKRF
TKSTKKIAITRLPQVLIINFKRFKMTTTGGFHKLETFVTYPVDKELDMTPYWPDVGSTIN
GNNSMSIEKEKEILSTFPVRSQVPPFKYKLFGVANHYGNLTTGHYTAYVYKSGDSKKTRN
WCYFDDSRVTFNKSPNDVLNKNAYCLFFQRI
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatttagtaaggctgacttcagaactagatcacatttcaaaaacattggttgaa
ttacttaaaaagaatcatgagagtttcaaatctttgttcaacgttcagcttgatctacta
aaactatttgacaaagaagtaaataatttagaatctatagggtactgtgattacgaggtg
gcatacgtactgtatatgatcattattcaattgatcgccgttatgaaaactaaatcaagt
cccaaaactgctgacatatacaatggaatacaacaatcaatccgaaagaaggcaagcaac
tttaaaatggtgttagggtattttaagaatgacgatgatgataaagatgatgaccccctt
atcaatcgattcaaatctttgagtggagaaaaaatacatacatcgactacaactaagaag
gaattgatatatcatgaatggataacccctgctgaacttgaaactacactttgcgaaaaa
catgtattgttaatagactacagactaaagaaggattatttacacaatcatatcaagttt
gaaaatttgataaatatagaaccacgacagattgaatcattaccacaatctgcgacagat
tctgatttggaagaagtgttgagaaaatctttgtcagagaaagagtttcagatgtttttg
gataggaacaaatttgatttcattatcgtgtataattataactatggttcgacttccaaa
gaaagactttatggaataatagatgtattagaaaacgaaaatccattcatttctttgata
ggaatattgatgaataacaaatacatcagctcgagattaaagatagctccgctgtttctt
tctggtggaattttaaattggtatcatactcttggtgcggattatttggagactacctca
acgaaaaattgtgatagctcaaatgaagaaactcgttacttgacttcatttagtgattac
ctttcgaattcaaaagaaagcctgccgtcagaaatcaaaattgtgaatggaagcagtagt
gcttatattaagccagttcaaaggaaaattgagcaatttgatcatttgccaccaaagagt
cctgctacggtatattcatcatccaaagttgaattacccttaactccaacttcatccata
cccaattcaccagcacctccctcgcagtcattgccatcaaatgggaagttaccaaacaat
gttacttccaaagatattactatttcttccaaaaagtcacaatttcttgaactgtatgcc
actggtttggtcaatttggggaattcatgctatatgaactgtgttatccaatgtttggcg
gcaactccacagcttacgtcattttttttcccaacaataactgaatcgttttcagataat
tcttacaaacgccatataaatgtgaacaacaaattagggacaaagggaatgttaacaacc
agttttgtcgaattaatattgagtatgctcaacaacaatggacgctcattcagcccttct
aagtttaagaaaataatgggatcgttatcaccatctcgacagtttgcttccttcgatcaa
caagactgtattgaattcttgaattttcttttggatgcacttcatgaagatcttaatcaa
gtgtctatagctgatcctcaagaaagaaagatgatcactgaattaacccctgagcaggaa
aaaaacagagaaatattgcctgttcggttagcttccactatagaatgggagcgatatctc
aaactaaatttctctattattgttgattatttccaagggcaatatttatcgcaattgaaa
tgtttagaatgtggatttacgtcaactacgtataatgcgttttcgatcctttcactaccc
atcccagaaaaattaaataaactgatgaaagtttctttggatgaatgccttcaggaattt
gtgacaactgagttacttgacgataataacaagtggtattgccccaattgcaaaagattc
accaaactgacaaagaaaatagctataactagactaccccaagtattgataataaatttc
aagaggttcaaaatgacaactactggcggttttcataaattggaaactttcgtgacttat
cctgtggataaagaattggacatgactccttattggccagatgttgggtctacaattaat
ggcaacaactcaatgtccatagaaaaggaaaaagagattttaagtactttcccagttagg
agtcaagtgccaccatttaaatataaattgtttggtgtggctaatcattacggtaatttg
acgactggacactatactgcttatgtctacaagagtggtgattcaaagaagactagaaac
tggtgttactttgatgattctagagttactttcaacaagtcaccaaatgatgtattgaat
aaaaatgcctattgtttattctttcagagaatataa

DBGET integrated database retrieval system