KEGG   Candida dubliniensis: CD36_12990Help
Entry
CD36_12990        CDS       T01140                                 

Definition
mitogen-activated protein kinase (MAP kinase), putative
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
cdu  Candida dubliniensis
Brite
Enzymes [BR:cdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CD36_12990
Protein kinases [BR:cdu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CD36_12990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:join(3120502..3120783,3120862..3121704)
Genome map
AA seq 374 aa AA seqDB search
MATLKNKNNNLKACSTYTDNENHFLVDSRYEIVRVLGKGSYGVVCSAIDTKSSVSAMEHK
IAIKKVTKIFNKDILLIRAIRELKFMMFFRGHKNIATLLDLDVVYVKPYEGLYCFQELAD
LDLARVLYSNVQFSEFHIQSFMYQILCGLKYIHSADVIHRDLKPGNILVTTQGTLKICDF
GLARGINPVYFRNRSAVITNYVATRWYRAPELIMSTKNYTKAVDVWAVGCILGELFGRRP
LFPGKNSHEQIHELFKIIGNPPIETIKKYNWKVEGLLWVKYRPVKWKSLYPFAPSNALEL
LDSLLQWDYKARLEVEQILEQDFFKNLRNVHEEPLSKAIFDFSFEEKGKSIPQLKEILET
EVRVFKEISKTGIE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggctacgctcaaaaacaaaaacaataatcttaaggcatgctcgacatacactgacaat
gaaaaccactttttggtcgattcgaggtacgaaattgtgcgagtgttggggaaaggatcg
tatggagtcgtttgctcagctattgatacaaaaagttcagtctcagcgatggagcacaag
attgccataaagaaagtaacaaagatcttcaacaaggacatccttttaattcgagcaata
cgagaactcaagtttatgatgtttttcagaggccacaagaatattgcaactttgcttgac
ttggatgttgtatatgtaaaaccttatgagggtttgtattgttttcaagagctagccgat
ttagatttagcccgtgttttgtattcaaatgtccaattttcagaatttcacattcaaagc
tttatgtaccaaatcctttgcgggctcaagtacatccactcagctgatgtaatacaccgg
gacctaaagcctgggaatatattggtcaccactcaagggacgttgaaaatatgcgatttt
ggcttagcacgaggaatcaatcccgtatattttagaaaccgctcagctgtaatcacaaac
tacgttgcaacacgctggtacagagctcctgaattaataatgtctactaaaaactacaca
aaagcggttgatgtctgggctgtgggctgtattcttggtgagttgtttggaagaagacct
ttatttcctggtaaaaacctgcatgagcaaattcatgaactattcaagataataggaaat
cctccaattgaaacaatcaaaaaatataactggaaggtagaaggactactttgggtaaag
tatagaccggtcaagtggaagagtttgtatccgtttgctccttcaaatgcattagagttg
ttagatagtcttctacaatgggattacaaagcaagattagaagttgaacaaatactagaa
caagactttttcaaaaatttgcggaacgttcacgaagaaccattgagcaaggcaattttt
gactttagttttgaggagaaaggaaagagtatcccacaattgaaagagatacttgaaacg
gaagtaagagtattcaaagagatttctaaaacgggaatagagtga

DBGET integrated database retrieval system