KEGG   Candida dubliniensis: CD36_15160Help
Entry
CD36_15160        CDS       T01140                                 

Definition
urate oxidase (uricase), putative (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
cdu  Candida dubliniensis
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cdu00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(28010..28921)
Genome map
AA seq 303 aa AA seqDB search
MQSELYSSTYGKGNVKFLKVKKDPSNPTVQDVLEANVQVLLRGKFDESYTKADNSSIVPT
DTVKNTILVEAKTTDVWPIERFAAHLAKHFTSKYGHVDGIEVTIIQAKWSKIRLEGKEHA
HSFKHEGPETRRTYLNYDKHTKKLQLSSSIKDLTVLKSTGSMFYGYNVCDYTTLQPTKDR
ILSTDVDASWTFDPAQITTLEDILSQPKLFDTTYNTARDVTLELFCKENSPSVQATMYNM
SHKILENVKEVGTVTYVLPNKHYVLFNLEWKGIKDNKDLFYPSPDPNGLIKCTVGRKGDK
AKF
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcaatccgaattatactcctccacctacggtaaaggtaatgtcaaatttttaaaagtc
aaaaaagatccatccaaccccactgtgcaagatgttcttgaagctaatgtccaggttttg
ttgagaggtaaatttgatgaatcatacaccaaagctgacaattcgtcaattgttcctact
gatactgttaagaatactattttagttgaagccaagaccactgatgtttggcccattgaa
aggtttgctgcacatttagctaaacatttcaccagtaaatacggacacgttgatgggatt
gaagttaccattattcaagccaaatggtccaagattagattagaaggtaaagagcatgct
cattcattcaagcacgaagggccagaaaccagacgtacctatttgaactacgacaaacac
accaagaaattacaattgtcttcttcaatcaaagatttgacggtgttgaaatcaactggt
tcgatgttttatgggtacaatgtgtgtgactacaccactttacaacctaccaaagataga
atcttgtctactgatgtcgatgcttcgtggacatttgatccggcccaaatcactactttg
gaagatatattatcacaaccaaaattgtttgacaccacatacaacactgccagagatgtt
acattagaattgttctgcaaagagaattctccatcggtccaagccaccatgtacaacatg
tctcacaagattttggaaaatgttaaagaggttggtaccgttacctatgttttaccaaat
aaacattatgtattgttcaatttggaatggaaaggtatcaaagacaacaaagacttgttc
tatccatcgccagatccaaatggtttgattaaatgtactgttggtagaaaaggtgacaaa
gctaagttttag

DBGET integrated database retrieval system