KEGG   Candida dubliniensis: CD36_15410Help
Entry
CD36_15410        CDS       T01140                                 

Definition
histone acetyltransferase, putative (EC:2.3.1.48)
Orthology
K11401  
histone acetyltransferase SAS2 [EC:2.3.1.48]
Organism
cdu  Candida dubliniensis
Brite
Enzymes [BR:cdu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CD36_15410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:68456..69511
Genome map
AA seq 351 aa AA seqDB search
MSATTTNIITASPKRKTKANTKEQDNSYYGQLNKRNINKVTFGKYEFPTWYGNAAYFYPH
DLSHSTLGYEYANKVASEGSMARKIHKKDVFDENLHEFWLNHLFVCEYCFKYTSNETTLN
QHVTACTYNRKRPNKGKLLYYDQANGYIIREVRGFQDPLFCQNLCLFGKLFLDDKSVYYN
IDHFDFYIVFGKDDSSYIPMGFFSKEVLSYDNDNNLACICIFPPFQRRHLGSLLIEFSYK
LAAVTPGQLKCSGPEFPLSPYGKVTYLRYWSKRLATKIYQQSGSFTLSQISKETGFRKED
ILLTLEYMQILVKDGNGNVALSLEYLEHWCSQNRVIPGVDINILNSECLIL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgctggcaactacaacaaacatcattacagcctcccccaagcgaaagacaaaagccaac
accaaagaacaagataactcttactatggacagttgaacaaacgaaatatcaataaagtc
acatttggtaaatacgagtttcctacatggtatgggaatgcagcatatttttacccccat
gatttatcacattcaaccttgggttacgaatatgccaacaaagtggcttctgaaggatca
atggctcgaaaaatccataagaaagatgtatttgatgaaaatttacacgaattttggcta
aatcatttgtttgtttgtgagtattgtttcaagtacacttccaatgagacaaccttgaat
caacatgtaactgcatgcacatataatcgaaaaagaccaaataaaggtaaattgttgtac
tatgaccaagccaatggatatataattcgagaagtgcgagggtttcaggatcctttgttt
tgtcaaaacttatgcttgtttggaaaattgttccttgacgataaatcagtgtattataat
atagatcattttgatttttatattgttttcggtaaagatgattcgtcatatattcccatg
ggatttttttctaaggaagtcttatcgtatgacaatgataataacctagcctgtatttgc
atattcccaccatttcaaagaagacatttgggctcattgttgattgagtttctgtataaa
ttggccgctgttactccaggacagctcaaatgcagcggcccagagttcccgctttcacca
tatggcaaagtaacttatttgaggtattggtcaaagagactagcgacgaagatttatcaa
caaagtggatcgtttacattgagccagatttcaaaagaaactgggttcagaaaagaagat
attctactaacacttgaatacatgcagatattggtcaaagatggtaatggaaatgtggca
ctttcgcttgaatatcttgaacactggtgctcacaaaatagggttattcccggggttgac
ataaatatcttgaattcggaatgtttaatactatga

DBGET integrated database retrieval system