KEGG   Candida dubliniensis: CD36_16820Help
Entry
CD36_16820        CDS       T01140                                 

Definition
deubiquitinating enzyme 14, putative (EC:3.1.2.15)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
cdu  Candida dubliniensis
Brite
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CD36_16820
Peptidases [BR:cdu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CD36_16820
Exosome [BR:cdu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CD36_16820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:393359..395725
Genome map
AA seq 788 aa AA seqDB search
MTLELPSDIPSTIPANTKIYKDDCMYSFDTPENNLLGLDIDLKTYRAYSRNKDFDYTKQN
FEKTGNHLYLNIKKTLKPQEERNKLLYDDNGEKSPKIQKLEIKNVSNDDYYNTEITIYDI
KDDRSYSRSELSEEFNNLIDSILSANSSATEDEIKQWEQEIVPCPHSIDVEQFDTGNLDL
TKCSQCDLRENLWICLHCGALGCGRQQYGSTLKGNGHALAHYELAQHPVAIKLGSLSADS
ESCDAYCYQCNDEVKVPHLGEKLHKFGIDLNTAVKTEKSLIELNIDQNLNWEFKLDGANG
ERLEPVYGKGLTGLQNLGNSCYINSVLQALYSLNGYQEYFKDKKFPDINNPAIDLTSQLI
KLYDGLQSGRYSVPGSLKGDDYQLGIKPSTFKNLIGENHPEFKTQRQQDAFEFLLYFLDK
VDTELGLKLNEELKFLLGTKVICANCSHGTLSNDLVDNISVPLEAEVIGKDEDGKKTYKE
VELIDSFKKYTAKEDIEGYKCENCHQQPGLAYKSTGFKTFPSTLIVNVQRIQLENWAPVK
VDVPITIPYNLDLTEFKAPVFETGEVGSKQKQPESENNTFVPNEEGMTTLLSMGFPEPRC
LKGLYHTGNSNAEDAMNWIFAHMDDADIDDPFNPNDSHASTNDSGPSQDLVDNVAAMGFS
TQLAKKALVLNNNDISAAVEWLFANPDDDGVLDNNQSNPVVNVNQEKSELITKLNASTQS
NGKYELQSVICHKGTSPHTGHYVVFIKKLIDNEYKWVLFNDEKVVVCDDANLQDIKNNAY
VYVFKKVE
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgacattagagttaccttcagacattccactgaccatacctgcaaacaccaagatatac
aaagatgattgcatgtattcttttgatacaccagagaacaatttgttagggttggatatt
gatctcaaaacatatcgagcttattctcgaaacaaggattttgattataccaaacaaaat
tttgaaaaaactggtaatcatttgtatttaaatatcaaaaaaactttaaaaccccaagaa
gagagaaacaaattattgtatgacgataatggtgaaaaatctccaaagatacagaaattg
gaaattaaaaatgtgtccaatgatgattattacaacaccgaaataactatttatgatatt
aaagacgatagaagttatagtagaagtgaattgagtgaagaattcaacaatttgattgac
tcgattctttctgcaaattcctctgccactgaagacgaaattaaacaatgggagcaagaa
attgttccttgtccccattcaattgatgttgaacaatttgacactggtaatttggatttg
accaagtgcagtcaatgtgatttgcgtgaaaatctttggatatgtttgcattgtggtgct
ttagggtgtggtagacaacaatatggatcaactttaaaaggtaatggacatgcattagct
cattatgaattagctcaacacccggtagcaataaaattgggatcattatcagctgattct
gaaagttgtgacgcatattgctatcaatgtaacgatgaagtcaaggtcccacatttggga
gagaagttacataaattcggtattgatttgaatactgcagtaaagaccgagaaatcatta
attgaattgaatatagaccaaaacttgaattgggaatttaaattagatggagccaatggt
gagagattagaacctgtatacggcaagggtttgactggtttacaaaacttgggtaattct
tgttatataaactcagtgcttcaagcactttattcattaaacggataccaagagtacttt
aaggataaaaagttccctgatataaacaatccggcaattgatttaacaagtcaattaatc
aaactttatgatgggctacaaagtggaagatattccgtcccaggttcattgaagggtgac
gactaccaattaggaatcaaaccttctacattcaaaaacttaattggtgaaaaccatcca
gaatttaaaactcagcgacaacaagatgcatttgagtttttgttgtactttcttgacaaa
gtggataccgaattgggattgaaactaaatgaggaattaaaattcttacttggtactaaa
gtcatctgcgccaattgttctcatggaactttgtcgaatgatttggttgacaatatctct
gtcccattggaagctgaagtgattgggaaagatgaagatggtaaaaagacttataaagaa
gttgaattaattgatagttttaaaaagtataccgccaaagaagatattgaaggatacaaa
tgtgaaaattgccaccaacaacctggtttagcatacaaactgacaggattcaaaacattc
ccatcaaccttgattgtaaatgttcaaagaattcaattggaaaattgggctccagtaaaa
gtcgatgtcccaattacaataccttataatttggacttgactgaattcaaagctcctgta
tttgaaactggggaagttggatccaaacagaaacaaccagagtcggagaataatacgttt
gttcccaatgaagaagggatgacaaccttattgagtatggggttcccagaacctagatgt
ctcaaaggtttataccacacaggtaatagtaatgcagaagatgctatgaattggattttt
gctcatatggatgacgccgatatcgatgatccatttaatccaaatgattctcacgcttca
acgaacgattctggtccatcacaagatttggttgataatgtagcggcaatgggattttcc
actcaattagcaaaaaaagcattggtattgaacaataatgatattagtgctgctgttgaa
tggttatttgccaatcctgacgatgatggagttcttgacaacaaccaaagtaatccagtt
gtcaatgtgaaccaagaaaaatcagagttaataacaaaactaaatgcatctactcaatcc
aatggcaagtacgagttgcaatcagttatatgtcacaagggtacatctccacatactggt
cactatgttgtttttattaaaaaacttattgataatgagtataaatgggtattgtttaat
gacgaaaaggtggtcgtttgtgatgatgccaatttacaagatatcaagaataatgcctac
gtgtatgtatttaaaaaggtagagtaa

DBGET integrated database retrieval system