KEGG   Candida dubliniensis: CD36_18020Help
Entry
CD36_18020        CDS       T01140                                 

Definition
(RefSeq) phosphoglycerate mutase 1, putative
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cdu  Candida dubliniensis
Pathway
cdu00010  Glycolysis / Gluconeogenesis
cdu00260  Glycine, serine and threonine metabolism
cdu00680  Methane metabolism
cdu01100  Metabolic pathways
cdu01110  Biosynthesis of secondary metabolites
cdu01130  Biosynthesis of antibiotics
cdu01200  Carbon metabolism
cdu01230  Biosynthesis of amino acids
Module
cdu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cdu_M00002  Glycolysis, core module involving three-carbon compounds
cdu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD36_18020
  Energy metabolism
   00680 Methane metabolism
    CD36_18020
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CD36_18020
Enzymes [BR:cdu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CD36_18020
Membrane trafficking [BR:cdu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CD36_18020
Exosome [BR:cdu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CD36_18020
  Exosomal proteins of melanoma cells
   CD36_18020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF4047
Motif
Other DBs
NCBI-GeneID: 8045838
NCBI-ProteinID: XP_002418280
UniProt: B9WB10
Position
2:682199..682945
Genome map
AA seq 248 aa AA seqDB search
MPKLVLVRHGQSEWNEKNLFTGWVDVRLSETGQKEAKRAGELLKEAGIKVDVLHTSKLSR
AIQTANIALDAADQLYVPVKRSWRLNERHYGALQGKDKAQTLETYGQEKFQIWRRSFDVP
PPTIDPKDQYSQVGDRRYADIDPAVVPLTESLALVIDRLLPYWQDEIAGDLLAGKVVLIA
AHGNSLRGLVKHLDNISDEDIAGLNIPTGIPLVYELDENLKPTKPSYYLDPEAAAAGAAA
VAAQGQKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagttagttttagttagacacggtcaatccgaatggaatgaaaagaacttgttc
accggttgggtagacgtcagattatcagaaactggtcaaaaagaagctaaaagagctggt
gaattattgaaagaagctggtatcaaagttgatgttttgcacacctccaaattatccaga
gccatccaaactgccaacattgccttggatgctgctgaccaattgtacgttccagtcaag
agatcctggagattgaatgaaagacactacggtgctttacaaggtaaagacaaggctcaa
actttggaaacttacggtcaagaaaaattccaaatctggagaagatcatttgatgttcca
ccaccaacaattgatccaaaggatcaatactcccaagtcggtgacagaagatacgctgac
attgacccagctgttgttccattgactgaatcattggctttagtcattgacagattattg
ccatactggcaagacgaaattgccggtgacttgttggccggtaaagttgtcttaattgcc
gctcacggtaactccttgagaggtttagttaaacacttggacaacatctcagatgaggat
attgctggtttgaacatcccaactggtattccattggtttacgagttagacgaaaacttg
aaaccaaccaaaccatcttactacttggacccagaagctgctgctgccggtgctgctgct
gttgctgctcaaggtcaaaagaaataa

DBGET integrated database retrieval system