KEGG   Candida dubliniensis: CD36_18020Help
Entry
CD36_18020        CDS       T01140                                 

Definition
phosphoglycerate mutase 1, putative (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cdu  Candida dubliniensis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:cdu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cdu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cdu00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:cdu00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cdu00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:682199..682945
Genome map
AA seq 248 aa AA seqDB search
MPKLVLVRHGQSEWNEKNLFTGWVDVRLSETGQKEAKRAGELLKEAGIKVDVLHTSKLSR
AIQTANIALDAADQLYVPVKRSWRLNERHYGALQGKDKAQTLETYGQEKFQIWRRSFDVP
PPTIDPKDQYSQVGDRRYADIDPAVVPLTESLALVIDRLLPYWQDEIAGDLLAGKVVLIA
AHGNSLRGLVKHLDNISDEDIAGLNIPTGIPLVYELDENLKPTKPSYYLDPEAAAAGAAA
VAAQGQKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagttagttttagttagacacggtcaatccgaatggaatgaaaagaacttgttc
accggttgggtagacgtcagattatcagaaactggtcaaaaagaagctaaaagagctggt
gaattattgaaagaagctggtatcaaagttgatgttttgcacacctccaaattatccaga
gccatccaaactgccaacattgccttggatgctgctgaccaattgtacgttccagtcaag
agatcctggagattgaatgaaagacactacggtgctttacaaggtaaagacaaggctcaa
actttggaaacttacggtcaagaaaaattccaaatctggagaagatcatttgatgttcca
ccaccaacaattgatccaaaggatcaatactcccaagtcggtgacagaagatacgctgac
attgacccagctgttgttccattgactgaatcattggctttagtcattgacagattattg
ccatactggcaagacgaaattgccggtgacttgttggccggtaaagttgtcttaattgcc
gctcacggtaactccttgagaggtttagttaaacacttggacaacatctcagatgaggat
attgctggtttgaacatcccaactggtattccattggtttacgagttagacgaaaacttg
aaaccaaccaaaccatcttactacttggacccagaagctgctgctgccggtgctgctgct
gttgctgctcaaggtcaaaagaaataa

DBGET integrated database retrieval system