KEGG   Candida dubliniensis: CD36_18050Help
Entry
CD36_18050        CDS       T01140                                 

Definition
delta-aminolevulinic acid dehydratase, putative (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cdu  Candida dubliniensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cdu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:687427..688452
Genome map
AA seq 341 aa AA seqDB search
MVHQAEFLPSTGNSISSVLQGGYNHPLSREWQQERQLTKNMFIFPLFITDSPDEETEIPA
LPNIKRFGVNRLIPYVKSLVEKGLRAVILFGVPLKPGVKDALGTAADDPEGPVITAIKKL
RENFPDLFIMCDVCLCEYTDHGHCGILNEDGSLRREESVQRIAAVAVNYARAGANSVAPS
DMMDGRIKDIKTGLMNAGLANKCLVMSYAAKFSGNLYGPFRDAAGSAPSHGDRKAYQLPP
GGAGLARRALMRDMGEGADAVIVKPSTFYLDIVSDAAKLCRDYPICAYHVSGEYAMLHAA
AEKGVVDLKGIAFEAHQGFLRAGARLIISYFTPEFLEWLQV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggtccatcaagctgagttcttaccttctacaggtaattcgatatcatctgtattacaa
ggtggttacaaccatccattgtctagggaatggcagcaggaaagacaattgaccaaaaac
atgtttatttttccattgtttatcaccgattctcctgatgaagaaaccgaaatccccgca
ttacccaacatcaagcgttttggtgtaaatagattgattccttatgtgaaaagcttagtt
gaaaaaggattgagagctgtgatattgtttggggttccattgaaaccaggtgtcaaagat
gcattgggtactgctgcagatgaccccgaaggaccagttattactgcgatcaaaaaatta
cgtgaaaatttccccgatttatttatcatgtgtgatgtttgtctttgtgaatacacagat
cacggacattgtgggatattgaatgaagatggatcattgagaagagaggaatcagtacaa
agaattgcagcggtggcggtcaactacgcaagagcaggagcaaactctgttgctccttca
gatatgatggatggacgtattaaagacatcaagaccgggttgatgaatgcaggattagcc
aataaatgtttagtcatgtcatatgctgccaagttctctggaaacttgtatggaccattt
cgtgacgctgccggaagtgcaccaagccatggagatagaaaagcataccagttaccacca
ggaggtgctggtttggcacgtcgtgcgttgatgagagacatgggtgaaggtgctgatgct
gttattgtcaaaccaagcactttttatttggacattgtcagtgatgcagccaaattatgt
cgtgattatccaatatgtgcatatcatgtcagtggagaatatgccatgttgcatgcagct
gcggagaaaggggtggttgatttgaaaggaattgcatttgaagcccatcaagggttttta
agagcaggagcaagattaattattagttatttcaccccagaatttttagaatggttgcaa
gtataa

DBGET integrated database retrieval system