KEGG   Candida dubliniensis: CD36_18080Help
Entry
CD36_18080        CDS       T01140                                 

Gene name
HOG1
Definition
map kinase hog1, putative (EC:2.7.11.24)
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
cdu  Candida dubliniensis
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CD36_18080 (HOG1)
Enzymes [BR:cdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CD36_18080 (HOG1)
Protein kinases [BR:cdu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   CD36_18080 (HOG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(697954..699087)
Genome map
AA seq 377 aa AA seqDB search
MSADGEFTRTQIFGTVFEITNRYTELNPVGMGAFGLVCSAVDRLTGQNVAVKKVMKPFST
SVLAKRTYRELKLLKHLKHENLITLDDIFISPLEDIYFVNELQGTDLHRLLSSRPLEKQF
IQYFTYQIMRGLKYIHSAGVIHRDLKPSNILINENCDLKICDFGLARLQDPQMTGYVSTR
YYRAPEIMLTWQKYDTEVDLWSVGCILAEMIEGKPLFPGKDHVHQFSIITELLGSPPADV
IDTICSENTLRFVQSLPHRDPIPFSERFASCTHVEPEAIDLLAKMLVFDPKKRISAAEGL
THPYMEPYHDPTDEPVCESKFDWSFNDADLPVDTWRVMMYSEILDFHQTVGVANETEGSE
HPDQQSDQNNLDSSNGA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgacggagaatttacaagaacccagatatttggaacagtttttgaaatcact
aatagatatactgagctaaatcccgtgggaatgggggcatttgggttggtgtgctcagcc
gtcgatagattaactggtcaaaatgttgctgtgaaaaaagtcatgaaaccttttctgact
tcagtattggccaaaagaacctacagagaattaaagttgttaaagcatttgaaacatgag
aatttgattactttagatgatattttcatatctcccttggaagatatttactttgtcaat
gaattgcaaggtaccgatttacataggttgttgagctcaagacctttagaaaaacaattc
attcaatatttcacatatcaaattatgagaggattaaaatacattcattctgccggagtt
attcatcgtgatttgaaaccatccaatatcttgatcaatgaaaactgtgatttgaagatt
tgcgattttggccttgcaagacttcaagatccacaaatgactggttacgtatcaaccagg
tattaccgtgcacctgaaatcatgttgacttggcagaaatacgacaccgaagtcgactta
tggtctgtgggttgtattttagcagaaatgattgaaggtaagccactattccccgggaag
gatcacgtgcaccagttctctattataacggaattattgggttcacctcctgctgatgtt
attgatactatctgttctgaaaataccttaagatttgtccaatcgttgccacatagagac
cctattccatttagtgaaagatttgcttcttgtactcacgtggaaccagaagcaatagat
ttattggctaaaatgctagtttttgaccctaaaaagagaattagtgctgcagaaggtttg
acccatccttatatggagccatatcatgatccaaccgatgagccggtttgtgaaagtaaa
tttgattggagttttaatgatgcagacttgccagtggatacctggagagttatgatgtac
agtgaaattttagactttcatcaaactgttggtgtggcaaacgagactgagggttctgaa
catccagatcagcaactggatcaaaataacttggactcaagcaatggagcataa

DBGET integrated database retrieval system