KEGG   Candida dubliniensis: CD36_19240Help
Entry
CD36_19240        CDS       T01140                                 

Definition
dual specificity protein kinase, putative (EC:2.7.12.1)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
cdu  Candida dubliniensis
Brite
Enzymes [BR:cdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CD36_19240
Protein kinases [BR:cdu01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   CD36_19240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(982056..984446)
Genome map
AA seq 796 aa AA seqDB search
MAYNNNNNSANYNYNFNRHNSIGGSWHLPPPPPPQPQPPSTGAYQQHLSPNNPNGQDILS
SDSQFSPQLKSNQIPGFRNPWFSQQQNATPNMLSSSSSSTSTSLSQSPTKSHQIPLLQQH
QPPLLNKRLSFTNNLPITYEHESTSNNNNNNNNNNNNNNNNDNGNNGNNNVPPYIHPPTR
ADNPFNHYFANQEVTLSNNDRRMSAAVDGTHYNPYGFNQQQLNAYPSGPAGVAGAQYLNN
PNLGPSINANRRSSVGVLPNYYRQQQQQQQQVQIQDPSAAATAAAAYYLPPARLGRSASI
VQYQQYQQALQNQRITKHKNPAPKARKIYNKLDLTPKFHQQPKYRRCSINSIHISPVNAL
SIYLTESYSLCQPRKFQYSKSTNPKRVLTKPSEPKYNNGYDNEDSDYILYVNDVLGSEEG
KKYMVLDLLGSGTFGQVVKCQNLINQTVCAVKVIKSKPAYMNQSLTEVRLLEFLNTNSDG
KNFIRLLDTFMHKEHLCLVFEILASNLYELIKQNQFQGLNMKLVKLLTKQLLDSMAQLKN
FQMIHCDLKPENILLCQPDKPNIKVIDFGSACFTRNTIYTYIQSRFYRSPEVILGLPYTE
SIDMWSLGCIVGELFLGLPMFPGTSEYNQIYKIVDMLGLPPRHMIEVGKNSLNFFKKKII
TTTTNTTNPDTKPIYELKSFDEYCQFLEYKRQKQEGNTTTNTTTTTNGSSQHHNHNYKKE
QPNKNYFKHKLLKDIIINYKLPSKKMTNSMIEKEYHDRLLLIDFLTKVLNLNPLERLTPQ
EALKHPFIIDVNTNDL
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atggcgtataataacaataataatagtgccaattataattataattttaatcgacacaat
tctataggaggaagttggcatttacccccaccaccaccacctcaacctcaacctccttct
acaggtgcataccaacaacatttatcacctaataatcctaatggtcaagatattttatca
tcagattcacaattcctgccacaattgaaatcaaatcaaattcctggattccgtaaccct
tggttttctcaacaacaaaacgctaccccgaatatgttatcatcttcttcttcatctaca
tcaacatcattatctcaatcaccgactaaatcacatcaaataccattattacaacaacat
caacctccattactaaataaacgattatcatttactaataatttgcccataacttatgaa
catgaaagtactagcaataacaacaacaacaacaacaacaacaacaataataataataat
aatgataatgggaataatggtaacaataatgtgccaccatatatacatccacctactcgt
gctgataatccatttaatcattattttgccaatcaagaagttactttaagtaataatgat
cgtagaatgtctgctgctgtagatggaacccattataatccatatggattcaatcaacaa
caactcaatgcttatccatctggtcctgctggagttgcaggtgctcaatatcttaataat
cctaatttgggtcccctgataaatgccaatagaagatcatctgtaggtgtattacccaat
tattatcgtcaacaacaacaacaacaacagcaagtacaaatacaggacccatcagcagca
gcaacagcagcagcggcatattatcttccaccagctagattaggaagatcagctctgatt
gttcaatatcaacaatatcaacaagcattacaaaatcaaagaataactaaacataaaaac
cctgcacctaaagcgaggaaaatatataataaattggatttaactcctaaatttcatcaa
caacctaaatatagacgatgttctataaattcaattcatatatctccagttaatgcatta
tcaatatatttaactgaatcatatagtttatgtcaaccaaggaaattccaatattccaaa
tcaactaatcctaaacgagttcttactaaaccactggaacctaaatataataatggatat
gataatgaagatagtgattatattttatatgttaatgatgtattgggaagtgaagaaggg
aaaaaatatatggtattagatttattaggatcaggaacatttggacaagttgttaaatgt
caaaatcttattaatcaaacagtttgtgctgttaaagtgattaaatcaaaaccagcatat
atgaatcaatcattaactgaagttcgattattagaatttttaaatactaatagtgatggg
aaaaatttcattagattattggatacatttatgcataaagaacatctttgtttagttttt
gaaatattggcatcgaatttatatgaattaattaaacaaaatcaatttcaaggtcttaat
atgaaattagtgaaattattaactaaacaattattagattcaatggcacaattgaaaaat
tttcaaatgattcattgtgatttaaaaccagaaaatattttattatgtcaacctgataaa
cccaatataaaagttattgattttggtagtgcttgttttactagaaataccatatatact
tatattcaatcaagattttatcgatcaccagaagtaatattaggattaccttatactgaa
tcaattgatatgtggtcattaggttgtatagtaggggaattatttttaggattaccaatg
tttcctggaacttcagaatataatcaaatttataaaattgttgatatgttaggacttcct
ccaaggcatatgattgaagttgggaaaaattcattaaatttttttaaaaaaaaaatcatc
accaccaccaccaataccactaatccagatacaaaaccaatttatgaacttaaatcattt
gatgaatattgtcaatttttagaatataaacgacaaaaacaagaaggaaatactaccaca
aataccaccaccaccacgaatggtctgctgcaacatcataatcataattataaaaaggaa
caaccgaataaaaattattttaaacataaattattaaaagatattattattaattataaa
ttaccttcgaaaaaaatgacaaattcaatgattgaaaaagaatatcatgatcgattatta
ttaattgattttttaactaaagtattaaatttaaatccattagaaagattaactcctcaa
gaagctttaaaacatccatttattattgatgttaataccaatgatctataa

DBGET integrated database retrieval system