KEGG   Candida dubliniensis: CD36_20220Help
Entry
CD36_20220        CDS       T01140                                 

Definition
mitogen-activated kinase kinase (MAKK), putative
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
cdu  Candida dubliniensis
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CD36_20220
Enzymes [BR:cdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     CD36_20220
Protein kinases [BR:cdu01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   CD36_20220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1186951..1188288)
Genome map
AA seq 445 aa AA seqDB search
MTSIPPLFKVPNTKRTSNNRVLPNLSIPPTTNNKNGNPNTKPGLSVNQNIINHDLQHENL
NPLSYQPQQNQHQQYQNPEGLKLSVSPSSASSSKSTKRKPPPIDTKVSDHSSDTMDAGQQ
GSTDEPEKVDENAYTVKHHLEQLTPYDWHLIANADKIVEVSSLGEGNGGAVTKCYIPQLP
NKQIFALKLVMCDPNPDLQKQIFRELEVAKKCQHPNIVKYYGTFLLEKQSMMGIAMEYMD
GQSLDSIYKEVLKRDKTNRINEKVLGKIANSILSGLDYLHSKNIIHRDIKPSNILLDTKG
NVKLCDFGVSGEAVNSFASTFVGTQYYMAPERITGGNYSITSDIWSLGMTLLEVANGSFP
IISSLGPIEVVEIISRSNLELKDCEEDNIFWTREFKQFIAKCLTKDYRRRPRPSDFLAHD
EWCLIQSKEKVKMDKFVKVVWELNE
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgatacctccgcttttcaaagtccctaatacaaaacgaacatcaaacaataga
gtattaccaaacttgtcaatcccacccacaaccaataataaaaatggcaacccaaataca
aaacccggtctactggtgaatcagaacattattaaccatgatctacaacatgagaatttg
aaccccttgtcatatcaaccacaacaaaatcagcatcaacaataccaaaaccctgaagga
cttaaattgtcggtctctccttcatctgcatcatcatcgaaatcaacaaaaagaaagcca
ccaccaatagataccaaagttagtgatcactcttcagatacaatggatgctggtcaacag
ggctcgactgatgaaccggaaaaagtggacgaaaacgcatacacagtaaagcatcatttg
gaacaactcacaccatatgactggcatttgattgctaacgctgataagatagttgaggtc
agtagtttaggtgaaggtaatgggggagctgtaaccaaatgctatattccacagttgcca
aataaacaaatatttgctttgaaattagttatgtgtgatcctaatcctgatttacaaaag
cagatattccgagaattagaagtagccaaaaaatgtcaacatcccaacattgtgaaatat
tacggtactttcctattagagaaacaatcaatgatgggtattgctatggaatacatggat
ggtcaatcattggattccatatataaagaagttcttaaacgtgataaaaccaatcgaata
aacgaaaaggttttgggcaagatagctaattctatcttgtctggattggactatttgcat
ctgaaaaatataatccatcgagacattaaaccttctaatattctattggataccaaaggg
aatgtcaaactttgtgattttggagtcagtggagaagcagttaattcattcgcttctacc
tttgttgggactcaatattatatggcaccagaacgtatcactggagggaattattctatc
accagtgatatatggtcgttgggtatgactctattggaagtagctaatggttcttttcct
attattctgtcgttgggtcccattgaagttgttgaaataatactgaggagtaatttggaa
ttgaaagactgtgaagaagacaatatattttggactagagagtttaaacaattcattgca
aaatgtttgacaaaagattaccgaagacgaccaagaccaagtgattttttagctcatgat
gaatggtgcttgatccaactgaaagaaaaggtgaagatggacaaatttgttaaagtggtg
tgggagttgaatgagtga

DBGET integrated database retrieval system