KEGG   Candida dubliniensis: CD36_21400Help
Entry
CD36_21400        CDS       T01140                                 

Definition
(RefSeq) replication factor A protein 2, putative
  KO
K10739  
replication factor A2
Organism
cdu  Candida dubliniensis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CD36_21400
   03420 Nucleotide excision repair
    CD36_21400
   03430 Mismatch repair
    CD36_21400
   03440 Homologous recombination
    CD36_21400
DNA replication proteins [BR:cdu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    CD36_21400
DNA repair and recombination proteins [BR:cdu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     CD36_21400
   MMR (mismatch exicision repair)
     CD36_21400
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     CD36_21400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2:1455880..1456686
Genome map
AA seq 268 aa AA seqDB search
MSDFGFDNYHGGGFNNTSQGGFTTEHAGSSQRQTATQVRQSLTPVTIKQINDATQPVPDA
EFKVNNVELNMISFVGVVRKVENMNASISVTIEDGTGSIDVRKWVDEAISTADEECQKYS
ELKDKYVFVGGSLKQFSNRKTVQNASISPITDSNQIVYHHLSAIEHHLKAQGISTTGAGG
QTTNATTSAGSGLFVDNPTTHSKGTGSMTDQVFAVLKESSNTMQAGVPVDYIIEKLNITK
EECLLHVGKLLEEGKVFAGYDDNAYVCL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattttggattcgataattatcatggtggagggttcaacaatacatctcaaggt
ggttttactactgagcatgctggatcatcgcagcgtcaaacagcaacccaagttagacag
agtttgacccctgtaacaatcaaacaaatcaacgatgcgacacaaccagtcccagacgcc
gagttcaaagttaataatgtcgaattaaatatgatttcatttgttggtgttgtacgtaaa
gttgaaaatatgaatgcatctatttcggtgactattgaagacggaactgggtctattgat
gtacgtaagtgggtggatgaagccatcagcacggccgacgaggaatgccaaaagtacagt
gagttgaaagataaatatgtttttgtgggtggatctttgaaacagtttagcaatcgtaaa
actgtccagaatgcgtctatttccccaataactgacagcaatcaaattgtgtatcaccat
ttgagtgcaattgagcaccatttgaaagctcaaggtatttcgacaactggtgctggtgga
caaacaacaaatgctaccaccagtgctggtagcggattgtttgtggataacccaactact
cactcaaaaggtacagggtcaatgacggaccaggtgttcgcagtattgaaagaaagcagt
aataccatgcaagcaggtgttccagttgactacattattgaaaaattgaatattactaaa
gaagaatgtcttttgcatgttggcaaattgcttgaagaaggcaaagtttttgctggttat
gatgataacgcttatgtctgtctttga

DBGET integrated database retrieval system