KEGG   Candida dubliniensis: CD36_21400Help
Entry
CD36_21400        CDS       T01140                                 

Definition
replication factor A protein 2, putative
Orthology
K10739  
replication factor A2
Organism
cdu  Candida dubliniensis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CD36_21400
   03420 Nucleotide excision repair
    CD36_21400
   03430 Mismatch repair
    CD36_21400
   03440 Homologous recombination
    CD36_21400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1455880..1456686
Genome map
AA seq 268 aa AA seqDB search
MSDFGFDNYHGGGFNNTSQGGFTTEHAGSSQRQTATQVRQSLTPVTIKQINDATQPVPDA
EFKVNNVELNMISFVGVVRKVENMNASISVTIEDGTGSIDVRKWVDEAISTADEECQKYS
ELKDKYVFVGGSLKQFSNRKTVQNASISPITDSNQIVYHHLSAIEHHLKAQGISTTGAGG
QTTNATTSAGSGLFVDNPTTHSKGTGSMTDQVFAVLKESSNTMQAGVPVDYIIEKLNITK
EECLLHVGKLLEEGKVFAGYDDNAYVCL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattttggattcgataattatcatggtggagggttcaacaatacatctcaaggt
ggttttactactgagcatgctggatcatcgcagcgtcaaacagcaacccaagttagacag
agtttgacccctgtaacaatcaaacaaatcaacgatgcgacacaaccagtcccagacgcc
gagttcaaagttaataatgtcgaattaaatatgatttcatttgttggtgttgtacgtaaa
gttgaaaatatgaatgcatctatttcggtgactattgaagacggaactgggtctattgat
gtacgtaagtgggtggatgaagccatcagcacggccgacgaggaatgccaaaagtacagt
gagttgaaagataaatatgtttttgtgggtggatctttgaaacagtttagcaatcgtaaa
actgtccagaatgcgtctatttccccaataactgacagcaatcaaattgtgtatcaccat
ttgagtgcaattgagcaccatttgaaagctcaaggtatttcgacaactggtgctggtgga
caaacaacaaatgctaccaccagtgctggtagcggattgtttgtggataacccaactact
cactcaaaaggtacagggtcaatgacggaccaggtgttcgcagtattgaaagaaagcagt
aataccatgcaagcaggtgttccagttgactacattattgaaaaattgaatattactaaa
gaagaatgtcttttgcatgttggcaaattgcttgaagaaggcaaagtttttgctggttat
gatgataacgcttatgtctgtctttga

DBGET integrated database retrieval system