KEGG   Candida dubliniensis: CD36_21480Help
Entry
CD36_21480        CDS       T01140                                 

Gene name
CaTPK2
Definition
Catalytic subunit of cAMP-dependent protein kinase (PKA), putative
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cdu  Candida dubliniensis
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    CD36_21480 (CaTPK2)
Enzymes [BR:cdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CD36_21480 (CaTPK2)
Protein kinases [BR:cdu01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   CD36_21480 (CaTPK2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1472104..1473405)
Genome map
AA seq 433 aa AA seqDB search
MVNLLKKLHITKSHQSNHSNSDSNSINSTTSMDTHQQQQQHQPQQLYPGEQIVHPAAAQT
GQNTTNVTAVTSSNITESATSSLYSQQLSHTDVTKSAAEEAIKRSLLPERSTISKGKYSL
TDFSIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQVVKMKQVEHTNDERRMLKLVEH
PFLIRMWGTFQDSKNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHSH
DIIYRDLKPENILLDRNGHIKITDFGFAKEVSTVTWTLCGTPDYIAPEVITTKPYNKSVD
WWSLGVLIFEMLAGYTPFYDSTPMKTYEKILAGKIHYPSFFQPDVIDLLTKLITADLTRR
LGNLINGPADIRNHPWFSEVVWEKLLAKDIETPYEPPITAGVGDSSLFDHYPEEQLDYGS
QGEDPYAQYFLDF
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatcttttgaagaaacttcatatcaccaagctgcatcaactgaatcattccaat
tcggacagtaattccataaactcaactacatcaatggacacacatcaacaacaacaacaa
caccaaccgcagcagctttatccgggagaacaaatagttcatcctgctgcagcccaaact
ggacagaatactacaaatgtgacagcggtgaccagttccaacattaccgaatctgctaca
tcatcactctattctcaacaattgctgcatactgatgttaccaaatcagctgctgaagaa
gccatcaaaagatctttgttgcctgaacgctctactatttcaaaggggaaatactctttg
actgatttctcaattatgagaactttgggaacaggttcctttggtagagtacatttagta
agatcagttcataatggtagatattacgctatcaaagtgttaaagaagcatcaagttgtg
aaaatgaaacaagttgagcatacaaatgacgaaagaagaatgttgaagttagttgagcat
ccctttttgattagaatgtggggaactttccaagactctaagaatttatttatggttatg
gattatattgaaggaggagaattattttcgttgttaagaaagtcacaaaggtttcctaac
ccagtagccaagttttatgctgcagaggttacgttagctttagaatatttacacagtcat
gatattatttatcgtgatttgaaaccagaaaatatattattggatagaaatggtcatata
aagattaccgattttggatttgccaaagaagttagtacggttacatggacgttatgtggt
accccagattatattgcaccagaagttataacaaccaaaccttataacaaatcagtagat
tggtggtcattaggtgtattaatttttgaaatgttggcaggttatacaccattttacgat
tcaactccaatgaaaacttatgaaaaaattttggcgggaaaaatacattatccaagtttt
tttcaacctgatgtgattgatttgttgactaaattaataactgctgatttgacaagaaga
ttgggtaatttgattaatggaccagcagacattagaaatcatccttggtttctggaagtg
gtgtgggagaaattattggccaaagacattgaaactccttatgaaccaccaattacagct
ggtgttggagactcgtcgttatttgaccattacccagaggaacaattagactacggaagc
caaggagaagatccttatgctcaatatttcctcgacttttag

DBGET integrated database retrieval system