KEGG   Candida dubliniensis: CD36_21600Help
Entry
CD36_21600        CDS       T01140                                 

Definition
Phosphatidylinositol 3-kinase, putative
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
cdu  Candida dubliniensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1493184..1500632
Genome map
AA seq 2482 aa AA seqDB search
MSASTSTSAQLQVVDGVALTEIFRGLTSTSEEERSKYAEELHNYLSSIARDLSSEQFNRY
NNDINKTIFDLLHGEKTAEILGGIAALNSLIEFDSGVGKENAGKTARFSNYLGSLILSND
LVIMKQAIRTLGKLATLGGNLTGDFVDFEAKRAIEWLQSDSKQHENRRHAAILIITALAD
NAPTLLYPLINQVLENLWTPLRDHKLIVREDAAIALEKCMHIIYDRDVNARSFWIKRMID
SASRLLNENDATDGADSSSSYNITFSGQSTENIHGSLLTYRELLKYFKDPFIVSRFEQIY
ENTYLYKNHKVAIIRQELTNIFPLLCKVNTELFVEKYLHRTLYYYLSQLKKYKAQNNETA
NADKSAIFKSIGLIALEVGNQIATYLDAILDNIREGLSYTSTAVVQSILAKAASNESPNI
STTNIASLTSGSKYTASRKETEPAIFYCISKLSIAVGPALTKHLQRDILDMMFANCSLSK
HMQDVLQILIENIPTLTNLINEKLLNLLSLVLSGKGFQPPGSPFGTIKVNTSLARDCRLI
MISRDTGMSANTILMNQEKYEKLDSKILIQALEMLAFFKFENYQLNEFVRYCTITYLEHN
NAKVRLTATVTSCQIFIKDPICQQVSVNALNTVNEVLGKLVSISITDPVPEIRLAGLNCL
IKAGNFDPQLSQANNVRLLFIALNDEVFGVRKVAIQILGRLSCINPAYIVPSLRKTLIQL
LSKLEYSTTSRKKEESAILLSLLISNSKELTRPYVKPIVDALLPKAKDLSSSVASSAIKC
LGELSVVGGEDLKPFIPDLMPLILDTFQDQSSSYKRDAALRTLGQLAFSSGYVIQPLLDY
PQLLGMLVAILKSETSPDIKRETVRLLGILGALDPYKHREVEQNSKNIPVEQNAPPVDVA
LLMQGMSPSNEEYYPKVAITNLMKILKDPSLSIHHTKVIQAVMYIFQTLGLRCVAFLPQI
IPGIINVMHTCQLSMLKFYFQQLGDIVLIVKQHIRPFLDDIFKVIKEFFNVGSQLNIQVT
IINVVQSVSRALDGEFKMYLPEVLTLMIGVFEEDKSVKRSPSLHVLKSFVVFGSNIEEFV
DIIVPHIVRLFETGPVELRRAAIETIGRLSKNVMLNDMASRIIHPILRILGQGSIELREP
CINTLTYMLVQLGPEFTVFIPVIKKTLLQKNIHAVKFEQLVGKLIGGDPLPLHLDIYKDY
DYSLYDVADTDMPSKKLPVNQASLKAAWDVSQRRTKEDWQEWIGRLSKELLLQSPSHAIR
ACAGLASDYYPLAKDLFNASFASCWSELYSQHKEELVESFFIALSSPSNPPEIHQTLLNL
AEFMEHDDKPLPIAISTLGQYAQRAHAFAKALHYKELEFYDQPTTPTIESLISINNQLQQ
SDAAIGILKHAQLHHDLQLKETWYEKLQRWDDALKAYNEREKIEPDNMEITIGKMRCLHA
LGEWEQLSELARSKWDSSSSEIKRSVAPLAAAAAWGLSQWDRMDACIKVMKAESPDKAFF
NAILSLHRNNFDDASVHILKARDLLVTEITALVSESYNRAYGVVVRVQMLAELEEIIKYK
CLPQGSEKRAVMRKTWNTRLLGCQRNVDIWQRMLKVRALVIKPKQDMDMWIKFANLCRKS
GRLNLAEKSLNLLLEEGSPENPSRAPPQVVYAQLKYMWAKGQRPEALRHLVDFTTRMSQD
LGLNPNDLITQPLPSEGPGIPRHVEEYTKLLARCFLKQGEWQIALNSNWRSETSEIILGA
YLLATHFDNKWYKAWHNWALANFEVISLYTSQSTSANNKIEILQDERNGSIEDGHSELKK
TDQQKQQQQQQQQQQQQANIIPIEAVQRHVIPSIKGFFHSIALSNSNSLQDMLRLLTLWF
KFGGIPEAAKAMTEGFNMVKIDNWLEVIPQLISRIHQPNEIVSRSLFALLTDLGKAHPQA
LVYPLTVAITSESTSRKRAAQSIIEKMRVHSPSLVDQAELVSRELIRVAVLWHEQWHDAL
EDASRFFFGEHNTEKMFETLEPLHQLLQKGPETMREQAFANAFGRELTDAYEWVLNFRRT
KDITNLNQAWDIYYNVFRRISKQVQSLASLELQYVSPDLEHAQDLELAVPGTYQAGKPVI
RIVKFDPTFSIISSKQRPRKLSCRGSDGKDYQYALKGHEDIRQDNLVMQLFGLVNTLLVN
DPECFKRHLDIQQYPAIPLSPKVGLLGWVPNSDTFHVLIKGYRESRSIMLNIEHRLLLQM
APDYDLLTLLQKVEVFTSAMDNCKGQDLYKVLWLKSKSSEAWLDRRTTYTRSLAVMSMVG
YILGLGDRHPSNLMLDRITGKVIHIDFGDCFEAAILREKYPERVPFRLTRMLNYAMEVSG
IEGSFRITCEHVMRVLRDNKESLMAILEAFAYDPLINWGFDFPTKALAESTGIRVPQVNT
AELLRRGQIDEKEAVRLQKQNELEIRNARAALVLKRITDKLTGNDIKRLRGLDVPTQVDK
LIQQATSVENLCQHYIGWCSFW
NT seq 7449 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcatctacatctacatctgcacagcttcaagtggttgatggtgttgctctaaca
gagatattcagagggcttacttcgacctctgaagaagagagatcaaagtacgcagaggaa
ctacacaattacttatcttcaattgcacgagacttatcctccgaacagtttaacaggtat
aacaacgacatcaacaagaccatatttgatttattgcatggtgaaaagactgctgagata
ttaggtggtatagcagcgctaaattcattgattgaatttgactcgggagtggggaaagaa
aatgcaggcaaaacagcaagattttcaaactatcttggttctttgatattgtccaatgat
ttagtaattatgaaacaagcaattcgtactttgggtaagctagccactctagggggaaat
ctcactggagattttgttgatttcgaagccaaaagagctattgaatggctacagagcgat
agcaaacaacacgagaatagacggcatgcagccatattgatcattactgcacttgcagat
aatgctcccactttattgtatcctttgattaatcaagttttggaaaatttgtggacaccc
ttaagggaccataagttgattgttcgtgaagatgctgctatagcacttgaaaaatgcatg
catatcatttatgatcgagacgttaacgcacgctcgttttggatcaaacgcatgattgat
ctggcatcaaggttacttaatgaaaacgacgccactgatggagctgattccagctcctca
tacaatatcacatttagcggacagtctactgaaaacatacatggatctttattgacgtac
cgtgagttactcaaatattttaaagatccgtttattgtgtcacgatttgaacagatttat
gagaatacatatttgtacaaaaaccacaaagttgcaatcataagacaagagctaacaaac
atattccctttgttgtgcaaggtaaacacagaattgtttgttgagaagtatttgcaccga
acattgtattattatttgtcacagttgaagaaatataaagctcagaataacgagacagcg
aatgctgataagagcgctatattcaaaagcataggattgattgctttggaagttggtaat
caaattgcaacttatttagatgcaatattggataatattagagaaggcttatcgtatact
tctactgcagtggtacagctgattttggccaaggctgcttcaaatgaatccccaaatatc
agcacaaccaacattgcatccttgacgtcaggttcaaaatacacggccagcagaaaagag
actgaacctgctattttttattgtatcagcaaattatctatagcagtagggccagcattg
acaaagcacttgcaaagagatattttggatatgatgtttgcaaactgctcgttatcaaag
cacatgcaagatgtccttcaaattttgatagaaaacattccaacattaacaaacttgata
aatgaaaaattattgaacttgctaagtttagttttgtctggtaagggatttcaaccacct
ggatcgccatttgggactataaaggtcaatacttcgcttgccagagattgccgattgatc
atgatatctagagacacgggaatgagcgctaacactattttgatgaatcaggaaaagtat
gaaaaacttgatagtaagatattgattcaagctttagaaatgttagcatttttcaaattt
gaaaattatcagttaaatgaatttgtcaggtactgcactatcacgtaccttgaacacaac
aacgcaaaagtgcgtcttactgcaactgttacgtcgtgccaaatattcattaaagatcca
atatgtcaacaagtcagtgttaatgcattgaatactgtaaacgaagttttaggtaaattg
gtgtctatttctattactgacccagttcctgaaattagattggcaggtttaaattgctta
ataaaagctggaaattttgatccacaattatcgcaagctaataatgtgaggttattgttc
attgcattgaatgatgaggttttcggtgttagaaaagtagctatacagattttggggaga
ttgtcgtgcatcaatccagcatatattgttccatccttaagaaagacccttattcagcta
ttatccaaattagagtattctaccaccagtagaaaaaaggaagaaagcgcaattttgttg
tctttacttattagcaattcaaaggaattaaccagaccatatgtgaagcctatagttgat
gctttgcttcccaaggccaaggatttgagctcctccgtagcttctagtgcaataaaatgt
ttgggggaattgtcggtggtcggtggtgaagatctcaaaccatttatccccgacttgatg
ccgttaattctagatactttccaagatcaaagttcatcttacaaacgggatgcggcattg
aggactttgggccaactagcattttcttcaggatatgtcattcaacccttgcttgattat
cctcagttgttagggatgttagtagcaatactaaaactggagacctctccagatatcaag
agagaaacagtccgattgttgggtattttgggggcacttgatccttacaaacatagggaa
gtcgaacaaaactccaagaatataccggttgagcaaaatgcgccaccagtagatgtggcc
ttgttaatgcagggaatgtcaccttccaacgaagagtattaccctaaagtggcaattact
aacttgatgaaaatattaaaagatccatccttaagtatccaccatacaaaggttattcag
gctgtaatgtatatttttcaaacattgggcttgaggtgtgtagcgttcttgccccaaatc
attccaggaattattaatgttatgcatacttgtcaattatctatgttaaaattttatttc
caacagctaggagatattgttttgattgtcaaacaacatattcgaccatttttagatgat
attttcaaagtcataaaggagttctttaatgttggctctcagttgaatattcaagtgaca
ataattaacgtggttcaatctgtgtcgcgtgctttggatggagagttcaaaatgtattta
cctgaagtcttgacactaatgattggggtttttgaagaagataaatctgtcaaacgctcc
ccgtctttgcatgttttgaaaagctttgttgtttttggaagtaatatcgaagaatttgtc
gacataattgtaccacatatcgttaggctatttgaaacaggtcccgtcgaattgcgcaga
gcagcaattgagactataggaaggttatcgaaaaatgttatgttgaacgatatggcatct
agaattatccatccaatattaagaattcttggtcaagggagtattgagcttcgcgagcca
tgcataaacactttgacatatatgttggttcagttgggtcccgagtttactgtttttatc
cctgtgattaaaaagaccttgttgcagaaaaatatccatgcagtcaagtttgagcaattg
gttggaaaattgattggtggagacccattaccactacatttggatatttacaaagattat
gattatagtctatatgatgttgcagatacggatatgccgtctaagaaattgcctgtaaat
caagcatcgttaaaggcagcttgggatgtaagccaacgaagaactaaagaagattggcaa
gagtggattggtaggttgagtaaggaacttttgcttcagagtccctctcatgccatcagg
gcgtgtgctggattggcatcagattattacccacttgcaaaagaccttttcaatgctagt
tttgctagttgctggagcgagctatattctcagcataaagaggaattggtggaatcgttt
tttattgcactttcatcaccaagcaatcctcccgaaatacatcaaacattattgaatcta
gctgagtttatggaacatgatgataaaccacttccaattgcgatttctacattgggtcaa
tatgcacaacgtgcccatgcgtttgcaaaggctttacattataaggaattggagttttat
gatcaacctacaacgcccacaattgaatcgttgattagtatcaataatcaattgcaacaa
tcggatgctgccataggtattttaaaacatgcacaattgcaccatgatttgcaattgaag
gaaacttggtatgagaaattgcaacgttgggacgacgctttgaaagcatacaacgaaaga
gaaaaaatcgagccagacaatatggaaattactattggtaaaatgaggtgtttacatgct
ttaggtgagtgggagcaattatcagaactagctcgaagcaaatgggatagttcatctagc
gaaatcaaacgaagtgttgcaccgcttgcagcagcagcagcttggggattgagtcagtgg
gacagaatggatgcatgtattaaagtcatgaaagcggaatcaccggataaggcttttttc
aatgctatcttaagtctccacagaaataactttgatgatgcttcagtgcatattttgaaa
gcgagagatttgcttgtgacggaaataactgctttggtgagtgaaagttacaatcgtgcc
tatggagttgttgtgcgagttcaaatgcttgcagagttggaagaaattatcaaatacaag
tgtttgccacaagggtctgaaaagcgagctgtcatgcgcaaaacttggaatacaagacta
ttgggatgccaaagaaacgtggatatatggcaaagaatgttgaaagttagagcattggtg
atcaaaccaaaacaagacatggatatgtggatcaaatttgccaatttgtgcagaaaatct
ggaagattgaatttggcagagaaatccttgaatttattattagaagaaggatctccggaa
aatccatcaagagctcctcctcaagttgtttacgctcaattgaagtatatgtgggccaag
ggccagaggccagaggctttgcgtcatttagtggattttaccactaggatgtcccaagac
ttagggttgaatccaaatgatttgattactcaaccattaccttctgagggtccaggtatt
ccaaggcatgttgaagaatacactaaattgttggcaaggtgtttcttgaagcaaggtgaa
tggcaaattgcattaaatagcaattggagatccgagacttcggagattattttgggtgca
tatttattggcaacccattttgacaataaatggtataaggcctggcataattgggcattg
gcaaattttgaggttatctccttgtacactagtcaaagcacgtcagccaacaataaaata
gagatcttacaagacgaacgcaatggttctattgaggatggccattccgaattgaaaaaa
actgaccagcaaaaacaacaacaacaacaacagcagcagcagcagcagcaagctaatatt
ataccaattgaagctgttcaaagacatgtcataccgtctatcaaagggttctttcattct
attgcattatctaattcaaactctcttcaagatatgttgagactacttacattgtggttt
aaatttggtggaattcctgaggcagccaaggccatgacagaagggtttaatatggtaaaa
attgataactggttggaagtaataccacaattgatttctcggatccatcaacctaacgaa
atagtgagtcgctccttatttgctttattgactgatttgggtaaagcacatccacaagca
ttagtttatcctttgactgttgcgattacttctgagtcaacaagccgtaaaagggcagct
cagtccatcattgaaaaaatgagagtgcactctcctagcttggtggatcaagcagaattg
gtgagtcgagaacttatccgagttgctgttttgtggcacgaacaatggcatgatgcattg
gaagatgctagcaggtttttctttggcgagcacaatacggagaagatgtttgaaacattg
gaaccattacaccaattgttgcaaaagggaccagaaacaatgcgagaacaagcttttgcc
aatgctttcggcagggaattgacagacgcgtatgagtgggtactcaactttagaagaact
aaagatataactaatttgaatcaggcatgggatatatactacaatgttttcagaagaata
agcaagcaggtgcaactgttggctagtcttgagttgcaatatgtgtctccggacttggag
cacgcccaagatttggaattagctgtgccaggtacttaccaagctggtaagcctgtaatc
aggatagttaagtttgatccaaccttttcgattatttcgtctaaacaaagacctagaaaa
ttatcctgtaggggaagtgatggtaaagactatcaatatgctttgaaagggcatgaagat
atcagacaggacaatttagtgatgcaattgtttggtttggttaatacgttgttggtaaat
gatccggaatgtttcaagagacatttggatatacagcaatatcctgctattccattatca
ccaaaagtgggattgttaggttgggttccaaatagtgacactttccatgttttgattaaa
gggtatcgtgaatcaagaagtataatgttaaatattgaacacaggcttttgttgcaaatg
gcgcctgactatgacttattgacgttgttgcaaaaagtggaagtatttacaagtgcgatg
gataattgtaagggtcaggatttgtacaaagtgttatggctcaaatctaaatcatccgaa
gcctggttggaccgtagaacaacatacacgagatcactagctgtaatgtctatggttggg
tacatattaggtttgggcgacaggcatccgtcaaatttgatgttagaccgtattacaggg
aaagtcatccatattgattttggggactgttttgaggcagcaatattacgtgagaagtat
ccagagagagtaccgtttagattgacgaggatgcttaattacgccatggaagttagtgga
attgaggggtctttcagaattacatgtgaacatgtcatgagagtgttgcgtgataataaa
gagtctctaatggcaatattagaagcatttgcttatgatcctttgataaattgggggttt
gatttcccaacaaaggcgttggctgaatcaacgggtatacgagtcccacaagtgaacact
gcagagttattacggagaggacagattgatgaaaaagaagctgtaaggttgcaaaaacaa
aatgagttggaaataaggaatgccagggctgcgctagtgttgaaacgtattaccgataag
ttaactggtaacgatataaaacggttaaggggattggatgtgcctactcaagtcgataag
ttgattcaacaagccacgagtgttgaaaatttgtgtcaacattatattggttggtgttca
ttctggtag

DBGET integrated database retrieval system