KEGG   Candida dubliniensis: CD36_23150Help
Entry
CD36_23150        CDS       T01140                                 

Gene name
DFG10
Definition
3-oxo-5-alpha-steroid 4-dehydrogenase, putative
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
cdu  Candida dubliniensis
Brite
Enzymes [BR:cdu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     CD36_23150 (DFG10)
    1.3.1.94  polyprenol reductase
     CD36_23150 (DFG10)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1843122..1843970)
Genome map
AA seq 282 aa AA seqDB search
MAIYDSQLIVVSLYLLIIIALYSAKFITPLNELLQYGKTSSQNVKKHDQPENSIIKQTIG
FISNYFVVPKSWFVHFYITLFALSSLIYLASFKEPISTDPEKFKNLILIHRLLWVQGIRR
LTECLTVSNFSKTSKMNVSHYIVGLSHYILVTWATYLGLSTYGSHQVPSNYTVFDIVLII
GFAICSLLQFQVHYHLSTLVKYTLPDFSFVSSPHYFYEILIYTILLSFAIKDGFDMVSVT
FFTSWLFVISNLSISSLETFSYYQKKYKEEFKLKWAILPGIL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggctatttatgacagtcaacttatagtggtttcactatacttgctaattattattgca
ttatattcagcaaagttcattactccattgaacgagttgttgcagtatgggaaaacttca
tctcaaaatgtgaagaaacatgatcagccagagaatagtattatcaagcagacaattggg
tttatatccaactattttgtggttcccaagtcatggtttgttcatttctacatcactttg
ttcgctttatcgtctttgatttatttggcgtcgttcaaggagccaatatcgaccgatcca
gaaaaattcaagaatttgattttgattcatcgattactctgggtccaaggaataagaaga
ttaactgaatgcctcactgtttccaatttttccaaaacctccaaaatgaacgtgagccat
tacatagtaggattaagtcattatattttagtgacttgggccacctatttagggctaagc
acatatggatcacatcaagtccctagcaattatacggtttttgatatcgtacttatcata
gggtttgccatttgttctttgctacaattccaagttcactatcacttgtcaaccttagtg
aagtacactttacctgacttcagctttgtttcgtctcctcattatttctatgaaatattg
atttacacaatcttgctcagtttcgcaattaaagatggtttcgacatggtttcagtaaca
ttctttacttcctggttatttgtcataagtaatctaagcataagttctcttgagaccttt
agttattaccagaaaaagtacaaggaagaatttaagttaaagtgggctatattgccaggc
atattgtag

DBGET integrated database retrieval system