KEGG   Candida dubliniensis: CD36_23700Help
Entry
CD36_23700        CDS       T01140                                 

Definition
protein disulfide-isomerase precursor, putative (EC:5.3.4.1)
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
cdu  Candida dubliniensis
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:cdu04141]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1985773..1987965
Genome map
AA seq 730 aa AA seqDB search
MKLSILSSLAFLTTTTAAAVVAGSEANPLVADQVTNDEPKRQSDAGSNSQPKMDVPPTLS
MKEFDKLTQEKLVLVEFFSPYCHHCKEFAPTWKETYIKFITEYPDLNIEMKQVNCIESGD
LCERENIDFYPNILLYAPAVDKNGKKTGKSKNIDSYPRNLDRNVENIIKYLREATAEYDS
GAINLPSSSQLLDVDTMSKIMEGNISTPMFVSFFPATAKQWESIEHRGRLGFSNCEDCLP
AKQIWDRLSNKVLSISDTGHFMCRDHREVCDKLKITTNSEPQFIMFLPESIGAIRFDYND
YVDVNRMKWWVQKLFQNSQFEVVSARGITEVMEYTKVLSHEPIAQFYPLKSKVTVVFYYD
VDKVTKEDEEILPHLLKTIQESPFNIQLHKGKHKKIEENVLTMGQNLIDYINYDENDKYE
FDKSLQVITTLTTKPTILVFKDNSLLADVYQSLSPEDMKTYDKVESFINSIQYPLYGQLT
PQLASYYFKKNEKYQDHKVVVLFTDLQDLKGTDNQLYKLSLAAHEYHHLKQKYYFDKFKQ
SNQGNAAAVEKLQEQNQETIDALKELRQVIPEIWENDQVLFTFIDLPNAYKQFRGVKGWK
LNPNNYQVGDVVVLSKDNRYYWNKDTQGNKLTNEPKVLKNVLMSLLAKDDQLKAAIVGSP
YGGVLGFMDYVHDYGVFGYIGFFLSIYIVGFLALRLGRRSSRRWLFKRPSSSTPSSGGII
GNNNFMPKKD
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatctatcttatcactgcttgcgttcttaacaacaacaacagcagcagcagta
gtagcaggctctgaggcaaacccactcgttgcagatcaagtaacaaacgatgaacccaaa
cgtcaatccgatgctggctcaaattcacaaccaaagatggatgttcctccaacattatca
atgaaagaatttgataaacttactcaagagaaacttgttcttgttgaatttttttcaccg
tattgtcatcattgtaaagaatttgcaccaacatggaaggagacatatataaaatttatc
acagaatatcctgatttgaatattgaaatgaaacaggtcaattgtattgagagtggtgat
ttatgtgagcgtgagaatatagatttttatcctaacatcttattgtatgcccctgcggta
gataaaaatggcaagaaaactgggaaactgaaaaatatcgattcatatccaaggaatctt
gatagaaatgttgagaatattatcaaatatttacgcgaagctacagctgagtatgattca
ggagcaattaatttgcctagttcttcgcaattgttagatgttgacactatgtccaagatc
atggagggaaatatttctactccaatgtttgtttcatttttccctgctacagcaaagcaa
tgggaaagcattgagcatcgaggcaggttggggttctcaaattgtgaggattgtttacct
gctaaacaaatatgggataggttatcaaacaaagtcttgtcaatttccgatacaggccat
ttcatgtgtcgtgatcatagagaggtttgtgacaagttgaagattaccactaatagcgaa
cctcaatttattatgtttttaccagaatcaataggggccattcgatttgattataatgat
tatgttgacgttaataggatgaaatggtgggtacagaaattattccaaaattctcaattt
gaagttgtgtccgctcgtggtataaccgaagtcatggaatacaccaaagtattgtcccat
gaacctattgctcagttttatccattgaaaagtaaagtaactgtagtgttttattatgac
gtggataaggtcactaaagaagatgaagagatattacctcatttactcaaaacaatccaa
gaatctccatttaatattcaactacacaagggcaaacataaaaaaatcgaagagaatgtt
ttaactatgggccaaaatttaattgattacataaattatgacgaaaatgataaatatgaa
tttgataaatccttacaagttataactactttaacaacaaaaccaacgatacttgttttc
aaagataattcattactcgccgacgtctatcaaagtttatcccctgaagatatgaaaaca
tatgacaaagtagagagtttcattaatagtatacagtatcctttatatggtcaattaaca
ccacaattggcttcttattattttaagaaaaatgaaaagtaccaagaccataaagttgtg
gtattattcaccgatttacaagacttgaagggaacagataatcaattgtacaaattatca
ttagcagcacacgaatatcatcatttaaaacagaagtattattttgataaattcaaacaa
agcaatcaggggaacgctgctgcagtggaaaaattacaggagcaaaatcaagaaactatc
gatgcattgaaggagttacgacaagtaataccagaaatatgggagaatgaccaagtcttg
tttacgtttattgatttacccaatgcatataaacagttccgtggagttaaaggatggaaa
cttaatcctaataattatcaagttggtgatgtggttgtgttatctaaagataaccgctac
tattggaacaaagatactcaagggaacaaattgacaaacgaaccaaaagtattaaagaat
gtattgatgtctttattagctaaggatgaccaattgaaagcagcaatagtgggtagcccc
tatggaggagttctagggtttatggattatgtacatgattatggagtttttggttatatt
ggttttttcttgtcaatttatattgttgggtttcttgctcttcgtctaggaagaagaagc
agtagaagatggctatttaaaaggccgtcttcatcgacacctagcagtggtggtataatt
ggtaataataattttatgcctaagaaggattaa

DBGET integrated database retrieval system