KEGG   Candida dubliniensis: CD36_24150Help
Entry
CD36_24150        CDS       T01140                                 

Gene name
CYC1
Definition
cytochrome c iso-1, putative
Orthology
K08738  
cytochrome c
Organism
cdu  Candida dubliniensis
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CD36_24150 (CYC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2100822..2101154
Genome map
AA seq 110 aa AA seqDB search
MPAPYEKGSEKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGVFGRKSGLAEGYSYTDANK
KKGVEWSEQTMSDYLENPKKYIPGTKMAFGGLKKPKDRNDLVTYLKKATS
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgccagctccatacgaaaaaggttcagaaaagaaaggtgctactttattcaaaactaga
tgtttacaatgtcataccgttgaaaaaggtggtccacataaagttggtccaaatttacat
ggtgttttcggtagaaaatccggtttagctgaaggttattcttatactgatgctaataaa
aagaaaggagttgaatggtctgaacaaaccatgagtgattatttagaaaacccaaagaaa
tatattcctggtactaaaatggcttttggtggtttaaaaaaaccaaaggatagaaatgat
ttagttacttatttaaagaaagctacttcttaa

DBGET integrated database retrieval system