KEGG   Candida dubliniensis: CD36_24180Help
Entry
CD36_24180        CDS       T01140                                 

Definition
deubiquitinating enzyme, putative (EC:3.1.2.15)
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
cdu  Candida dubliniensis
Brite
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CD36_24180
Peptidases [BR:cdu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CD36_24180
Transcription machinery [BR:cdu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CD36_24180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2106965..2108710
Genome map
AA seq 581 aa AA seqDB search
MPSDETISKSNGNINTATNNIPTTTTTTAAITQQQDGQDILEDQSTLFYNKLNFVRELTP
RPDNYSTINSCNHIDSVLRSKAKTTVFETYRQAVLISQPLIKSYKLKKDGSIIPIKKLIM
SKISALKCSQCHLNNFNNSMICLQCPHVGCCFNDYNHSYSHYKSTKHMFSIDSSCGLLYC
FKCNDFINHPELEKIRLQIILGDDDNIENINDKNNKDMNNFIKQNYVDPGKIAIKGLKGF
INLGATCFMSSILQTLIHNPLIKYQFFNNDLHYFNCEKIHNQFINNGNIDENNACITCSI
DNIFQSFYTSTTNEGFGMTNLLTTAWYKQKSLAGFEEQDAHEFWQFLLNEFHMDYQRIIM
NLKNEKLSNISKNDGLESVINSNSCGCIMHSTFSFELQSCIKCNSCESITETVDPMIDLS
LEVNFTNLYQSLQSFTRDEKLDDYNCKNCNTTTTTTNNNNNGNSKTSAIKKLRLKTLPQI
LSIQLKRFRHDTLGSFQATKIQSHIDFPLFLNVTEYSVINDTDYIYQLFAVVVHQGSINT
GHYTVFIKNNGNWYKFDDSVVTMVSQDDVINSEAYLLYYIV
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgccttctgatgaaacaatatctaaatcgaatggcaatatcaatactgccaccaataat
attcctactactactactactactgctgccattacacagcaacaagacggacaagacata
ctagaggatcaatcgacattattttataataaattgaattttgttcgagaattaacacct
cgacccgataattattccacaattaattcatgtaatcatattgattcagtcttaagatcc
aaagctaaaaccactgtatttgaaacttatagacaagcagtattaatatctcaaccatta
attaaatcatataaattgaaaaaagatggatcaattataccgattaaaaaattaattatg
tcgaaaatatcagcattaaaatgtagtcaatgtcatttaaataattttaataattcaatg
atttgtttacaatgtcctcatgttggttgttgttttaatgattataatcattcttattcc
cattataaatcaactaaacatatgttttctattgattcaagttgtggattattatattgt
tttaaatgtaatgattttattaatcaccctgaattagaaaaaattcgattacaaattatt
cttggtgatgatgataatattgaaaatattaatgataaaaataataaagatatgaataat
tttattaaacaaaattatgttgatccaggaaaaattgctataaaaggattaaaaggattt
attaatttaggagcaacatgttttatgagttcaattttacaaactttaattcataatcca
ttaattaaatatcaattttttaataatgatttacattattttaattgtgaaaaaattcat
aatcaatttattaataatgggaatattgatgaaaataatgcatgtataacatgtagtatt
gataatattttccaatcattttatacatcaactactaatgaaggatttggtatgactaat
ttattaactactgcttggtataaacaaaaatcattagcaggatttgaagaacaagatgct
catgaattttggcaatttttattaaatgaatttcatatggattatcaaagaattataatg
aatttaaaaaatgaaaaattgtcaaatatatccaaaaatgatggattagaatcagtgata
aattcaaattcttgtggatgtattatgcattcaacattttcatttgaattacaaagttgt
attaaatgtaattcttgtgaatcaattactgaaactgttgatccaatgattgatttatca
ttagaagtcaattttacaaatttatatcaatctttacaatcatttactagagatgaaaaa
ttagatgattataattgtaaaaattgtaacaccaccaccaccaccaccaacaataacaat
aacggtaattcaaaaacttcagcaattaaaaaattacgattgaaaactttaccacaaata
ttatcaattcaattgaagagatttagacatgatacattaggtagtttccaagcaacaaaa
attcaatctcacatagatttcccattatttttaaatgttacagaatattcagttattaat
gataccgattatatttatcaattatttgcagttgttgttcatcaaggatcaattaatact
ggtcattatacagtatttataaaaaataatggtaattggtataaatttgatgatagtgta
gttaccatggtttctcaagatgatgttatcaattccgaagcatacttattatactatata
gtttaa

DBGET integrated database retrieval system