KEGG   Candida dubliniensis: CD36_24180Help
Entry
CD36_24180        CDS       T01140                                 

Definition
deubiquitinating enzyme, putative (EC:3.1.2.15)
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
cdu  Candida dubliniensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2106965..2108710
Genome map
AA seq 581 aa AA seqDB search
MPSDETISKSNGNINTATNNIPTTTTTTAAITQQQDGQDILEDQSTLFYNKLNFVRELTP
RPDNYSTINSCNHIDSVLRSKAKTTVFETYRQAVLISQPLIKSYKLKKDGSIIPIKKLIM
SKISALKCSQCHLNNFNNSMICLQCPHVGCCFNDYNHSYSHYKSTKHMFSIDSSCGLLYC
FKCNDFINHPELEKIRLQIILGDDDNIENINDKNNKDMNNFIKQNYVDPGKIAIKGLKGF
INLGATCFMSSILQTLIHNPLIKYQFFNNDLHYFNCEKIHNQFINNGNIDENNACITCSI
DNIFQSFYTSTTNEGFGMTNLLTTAWYKQKSLAGFEEQDAHEFWQFLLNEFHMDYQRIIM
NLKNEKLSNISKNDGLESVINSNSCGCIMHSTFSFELQSCIKCNSCESITETVDPMIDLS
LEVNFTNLYQSLQSFTRDEKLDDYNCKNCNTTTTTTNNNNNGNSKTSAIKKLRLKTLPQI
LSIQLKRFRHDTLGSFQATKIQSHIDFPLFLNVTEYSVINDTDYIYQLFAVVVHQGSINT
GHYTVFIKNNGNWYKFDDSVVTMVSQDDVINSEAYLLYYIV
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgccttctgatgaaacaatatctaaatcgaatggcaatatcaatactgccaccaataat
attcctactactactactactactgctgccattacacagcaacaagacggacaagacata
ctagaggatcaatcgacattattttataataaattgaattttgttcgagaattaacacct
cgacccgataattattccacaattaattcatgtaatcatattgattcagtcttaagatcc
aaagctaaaaccactgtatttgaaacttatagacaagcagtattaatatctcaaccatta
attaaatcatataaattgaaaaaagatggatcaattataccgattaaaaaattaattatg
tcgaaaatatcagcattaaaatgtagtcaatgtcatttaaataattttaataattcaatg
atttgtttacaatgtcctcatgttggttgttgttttaatgattataatcattcttattcc
cattataaatcaactaaacatatgttttctattgattcaagttgtggattattatattgt
tttaaatgtaatgattttattaatcaccctgaattagaaaaaattcgattacaaattatt
cttggtgatgatgataatattgaaaatattaatgataaaaataataaagatatgaataat
tttattaaacaaaattatgttgatccaggaaaaattgctataaaaggattaaaaggattt
attaatttaggagcaacatgttttatgagttcaattttacaaactttaattcataatcca
ttaattaaatatcaattttttaataatgatttacattattttaattgtgaaaaaattcat
aatcaatttattaataatgggaatattgatgaaaataatgcatgtataacatgtagtatt
gataatattttccaatcattttatacatcaactactaatgaaggatttggtatgactaat
ttattaactactgcttggtataaacaaaaatcattagcaggatttgaagaacaagatgct
catgaattttggcaatttttattaaatgaatttcatatggattatcaaagaattataatg
aatttaaaaaatgaaaaattgtcaaatatatccaaaaatgatggattagaatcagtgata
aattcaaattcttgtggatgtattatgcattcaacattttcatttgaattacaaagttgt
attaaatgtaattcttgtgaatcaattactgaaactgttgatccaatgattgatttatca
ttagaagtcaattttacaaatttatatcaatctttacaatcatttactagagatgaaaaa
ttagatgattataattgtaaaaattgtaacaccaccaccaccaccaccaacaataacaat
aacggtaattcaaaaacttcagcaattaaaaaattacgattgaaaactttaccacaaata
ttatcaattcaattgaagagatttagacatgatacattaggtagtttccaagcaacaaaa
attcaatctcacatagatttcccattatttttaaatgttacagaatattcagttattaat
gataccgattatatttatcaattatttgcagttgttgttcatcaaggatcaattaatact
ggtcattatacagtatttataaaaaataatggtaattggtataaatttgatgatagtgta
gttaccatggtttctcaagatgatgttatcaattccgaagcatacttattatactatata
gtttaa

DBGET integrated database retrieval system