KEGG   Candida dubliniensis: CD36_24400Help
Entry
CD36_24400        CDS       T01140                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cdu  Candida dubliniensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CD36_24400
Enzymes [BR:cdu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CD36_24400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2169344..2170144
Genome map
AA seq 266 aa AA seqDB search
MTNVILLKNASIPSDPYDIKFSNSNKYKPNFVPLLTHCHKDKSQTLSFLISDEFLNNIPI
FIITSQRAVEMFKECIEELDHDIREKIYQKIGYTVGPATYKILKSVGFKDVRGGDEAGNG
SKLADLIKQDTIGRENIPMVFFTGVIRKDIIPMKLINSGYDNFQEFILYQTGDRLDIIDN
FKKVIQGLDKDDVWIVFFSPQGTKEIVNYLMNSSSNQNQNWKIASIGPTTRDYLKDFDLT
PHVISPKPDPEALFETIFQYDKTYAL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgactaatgttatactactaaagaatgcaagtataccttctgatccatatgatatcaaa
ttttccaattccaataaatataaacccaattttgttccattattgactcattgtcataaa
gataaatcccaaacattatcatttttaattagtgatgaattcttaaacaatataccaatt
tttataatcacttcccaacgagccgttgagatgtttaaagaatgtattgaagaattagat
catgatatacgagagaagatatatcagaaaataggatataccgtggggccagctacttat
aaaatattgaaatcagtaggatttaaagatgtacgagggggagatgaagcagggaatgga
tcgaaattagctgatttaattaagcaagatactataggaagagaaaatatccccatggtt
ttctttactggagtgattagaaaagatattatccctatgaaattaattaatagtggatat
gataatttccaggaatttatactttatcaaactggtgatcgattagatattattgataat
tttaaaaaagtaattcaagggttagataaagatgatgtttggatagtatttttcagtccc
caaggaactaaagaaattgttaactatttaatgaatagtagttcaaatcaaaatcaaaat
tggaaaattgcttctattggtcctacaacaagagattatttaaaagattttgatttaaca
ccacatgtgatatcaccaaaacctgatcctgaagctttatttgaaactatatttcaatat
gataaaacttatgcattgtaa

DBGET integrated database retrieval system