KEGG   Candida dubliniensis: CD36_24410Help
Entry
CD36_24410        CDS       T01140                                 

Definition
acetate--CoA ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cdu  Candida dubliniensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cdu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cdu00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cdu00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cdu00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:cdu00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2170393..2172423)
Genome map
AA seq 676 aa AA seqDB search
MPESTQQSHLSLDHEKMQQPPKGFTERSKTKPNLPDFETYEKLYKQSIENPNEFFSQQAK
ENLDWFKPFDLARFPVDPKDDYKNGDLPAWFINGQLNACYNAVDRWAIKNPGKPAIIYEG
DEPDQGRIITYGELLKQVSKLAQALTKLGVKKGDSVAVYLPMIPEAIVTLLAIVRIGAMH
SVVFAGFSSASLRDRILDADSRIVITADESKRGGKTIETKKIVDDALKECPKVRNVIVFK
RTGNSHVPFSPGRDLWWHDEMAKYGPYFPPVPVNSEDPLFLLYTSGSTGKPKGVQHNTAG
YLLGAVLTTKYTFDVHEDDILFTAGDIGWITGHTYCVYGPLLAGATSVVFEGTPAYPNYS
RYWEIVDKYKVNQFYVAPTALRLLKRAGTKYVEKYDLSSLRVLGSVGEPIAAEVWHWYND
NIGRGQAHIVDTYWQTESGSHLLTPLAGITPTKPGSASLPFFGVDPKILDPTTGEELPDN
DVEGVLAIKSAWPSITRGIYNDYNRFIDTYLAPYQNYYFSGDGAARDRDGFYWILGRVDD
VVNVSGHRLSTAEIEAALIEHPIVGESAVVGYADELTGQAVAAYVSLKKDKAVGEDVENI
KKEMILTVRKEIGPFAAPKMILLVDDLPKTRSGKIMRRILRKVLAGEEDQLGDISTLSNP
GVVQQIIDVVHHAKKK
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgccggaatctactcaacaatctcatctttctttggaccatgagaagatgcaacaacct
ccaaaagggttcacagaacgttctaaaacgaaaccaaatttacctgattttgaaacttat
gagaaattatataaacaatccattgaaaatcctaatgaatttttctctcaacaagccaaa
gaaaatttggattggttcaaaccatttgatttagctagatttcctgttgaccctaaagat
gattacaaaaatggggatttacctgcttggtttatcaatggacaattgaatgcttgttat
aatgctgttgatagatgggccattaaaaaccctggtaaaccagctattatttatgaaggt
gatgaacccgatcaaggtagaatcatcacttatggtgaattattaaaacaagttagtaaa
ttggcccaagctttgactaaattgggcgtcaaaaaaggtgattcagttgcagtttattta
ccaatgattcctgaagccattgtcactttattagccattgttagaattggtgccatgcac
tcggttgttttcgctgggttttcttctgcttcattaagagatagaattttggatgccgat
tcaagaattgttattactgctgatgaatctaaaagaggtggtaaaaccattgaaacgaaa
aaaattgttgatgatgccttgaaagaatgtccaaaagttagaaatgtcattgttttcaaa
agaactggtaattctcatgttccattttctcctggtagagatttatggtggcacgatgaa
atggctaaatatggtccatacttcccaccagttccggtcaattctgaagatccattattt
ttgttgtatacttctggttctactggtaaaccaaagggggttcaacacaacactgctggt
tatttattaggtgctgttttgaccaccaagtatacttttgatgttcatgaagatgatatc
ttgtttactgctggtgacattggttggatcactggtcatacttattgtgtttatggtcca
ttgttagctggtgccacttcagtggttttcgaaggtactcctgcttatccaaactattct
cgatactgggaaattgttgataaatacaaagttaatcaattttatgttgccccaactgct
ttaagattattgaaaagggctggtaccaaatatgttgaaaaatacgatttgtcatcttta
agagtattgggttcagttggtgaaccaattgctgctgaagtttggcattggtataatgat
aacattggtagaggtcaggctcatattgttgatacttattggcaaactgaatctggatct
cacttgttgactccattggccggtattaccccaaccaaaccaggttcagcttcattacca
ttctttggggttgatccaaaaattttagatccaaccactggtgaagaattgcctgataat
gatgttgaaggggttcttgccattaaatcagcttggccatcaattactagaggtatttat
aatgattacaatagatttattgatacttatttggcaccatatcagaattattatttctct
ggtgatggtgctgctagagatagagatggattttattggattttgggtagagttgatgat
gttgttaatgtttctggtcacagattatcaactgctgaaattgaagctgctttgattgaa
catccaattgtcggtgaatctgccgttgttggttatgccgacgagttgactggtcaagct
gtggctgcttatgtttcattaaagaaagataaagctgttggtgaagatgtggaaaacatc
aagaaagaaatgattttaacggtaagaaaagaaattggaccatttgctgcccccaaaatg
attttattggttgatgatttacctaaaactagatctggtaagattatgagaagaatttta
agaaaggtattggctggtgaagaagaccaattgggtgatatttcaactttatccaatcca
ggtgtcgttcaacaaatcatcgatgttgttcatcatgcaaagaagaaatag

DBGET integrated database retrieval system