KEGG   Candida dubliniensis: CD36_24530Help
Entry
CD36_24530        CDS       T01140                                 

Definition
dna repair and recombination protein rdh54, putative (EC:3.6.1.-)
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
cdu  Candida dubliniensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cdu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2222220..2224868)
Genome map
AA seq 882 aa AA seqDB search
MFSRSKKKKKKKKKKRKSYLSNKTRIKTIRSDWTQSCSFFTTPQVVQMNIRPNAPFRPPR
PIQKNGDVPSVSTASSVVKRKLPTISNPKAAKILTPEAKNLKPSESIDFGSEKYSIQWRK
RTTKKNKTWDGDGYAVIKQLENGTWQMSIKNSDGKPMCKRIFNATPNLEDIISVGPYELE
LDEKMELQESTSSVLSKAVPKSIPPPIVSRNITHQFKKVAPPTHTEPANFRKPLYQDSPD
AIALPPPPKSKDYVTVNVDPHLSKVLRPHQVEGVRFMYECLMGYRDFDGNGCLLADEMGL
GKTLMTITTIWTLLKQNPFLDQKNAVVNKVLVVCPVTLISNWRQEFKKWLGANKLNVLTL
NNAMTNEKRDILNFGKLNVYQVLVVNYEKIMAHFDELSTVSFDLLVCDEGHRLKNSANKV
LNNLIKLNIPKKVVLTGTPIQNELVEFHTLISFLNPKVLPELKLFQRNFITPISRARDVN
CFDPEVKKRGEEISQQLIKLTQSFILRRTQSILANYLTQKTDILLFVPPTSSQLELFNYI
TNLKKFNQFNSGSDSFTMINLFKKICNSPSLLADDEFFKKIVEQKFNLGMSSGKLNILVP
LLLEIVSLKEKIVLISNYTKTLDLLETVLRKINLTFSRLDGSTPNNVRSKLVNQFNTNPD
INVFLLSSKSGGMGINLVGASRLILFDNDWNPATDLQSMSRIHRDGQVKPCFIYRLFTTG
CIDEKIFQRQLVKNKLSSKFLDNDSSSKSDVFDSEDLKNIFEIDTSTISNTHDLLECSCE
GDGSTLSQSTLSFKESEEHDSEPPATQAWVSALELQKKLDNNDDAVKRTAVKFALNDYRH
YNPEVNRNLEFDSALQRIANNSSYKNKKLPITFIMSRITNRE
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgttttctcgactgaaaaaaaaaaaaaaaaaaaaaaaaaagaaacgaaaatcgtattta
tcaaacaaaacgcgtatcaaaacaattagactggactggacccaatcttgctcttttttt
actacaccacaggttgttcaaatgaatattcgacccaatgctccgtttcgacctcctaga
ccaattcagaaaaatggggatgttccactggtatcaacagcgtctctggtggtaaaacga
aaattgccaactatctcaaatcctaaagctgcaaagatcttaacaccagaagctaagaat
ttgaaaccatccgaatctatagattttggttcagagaaatacctgattcaatggagaaaa
agaactaccaagaaaaacaaaacttgggatggtgacggttatgcagtgattaaacagctt
gaaaatggtacttggcaaatgtctattaagaattctgatgggaaacctatgtgtaagaga
atatttaacgcaacgcctaatcttgaagacataattagcgtgggtccatatgaattagaa
ttggacgaaaaaatggagctccaagaatctacctctctggtgctttcaaaggctgttccc
aaaagcatcccaccacctatagtgtctcgaaacatcacccaccaattcaaaaaagtcgct
cctccaacacacactgaaccagctaattttcggaagccgctttatcaagatagtccagat
gctattgcgttacctcctcctccaaaatcaaaggactatgtaacagtgaatgtggaccca
catttgtcaaaagtattacgtccacatcaggttgaaggtgtaagattcatgtacgagtgc
ctaatgggttaccgtgactttgatggaaatggatgtttgttagcggatgaaatggggttg
ggcaaaactttgatgacaatcacaacaatatggactttgcttaaacaaaatccgttttta
gatcaaaaaaatgctgtcgtgaataaagtattggttgtttgccctgtaacacttatatct
aattggaggcaggaatttaaaaagtggctaggggccaataagctaaacgttttgactctc
aataacgcaatgacaaatgagaaacgtgacattcttaactttggaaagttaaatgtctat
caagtgctagtggtaaattatgaaaaaattatggctcattttgatgaattatcaacagta
agctttgatttattagtctgcgatgaaggccatcgtttgaagaatagtgcaaacaaagta
ttgaataatcttatcaagcttaatattcccaagaaagtcgttttgaccggtacaccgatt
caaaacgagttggtagaattccatactttgatttcatttctcaatccaaaggttcttcct
gagctaaaattgtttcaaagaaactttataacacccatatctagggctcgagatgtcaac
tgttttgatcctgaagtgaagaaacggggcgaggaaatctcacagcaattgattaaattg
acacagagttttattcttaggcggacacaatcgattttagcaaattacttgacacaaaaa
accgacatcttgttgtttgtccctcctacgtcctcacagctagaattgttcaactacata
acgaatttgaagaaatttaatcaattcaatagcggatctgactcattcacaatgatcaat
ttgttcaaaaagatttgtaattctccttcattattggcagacgatgagttttttaaaaaa
attgttgaacaaaagtttaatttgggtatgtcctctggtaaattaaatattctagtgccc
ttgctattagaaattgtgtctcttaaagaaaaaattgtgttgatttcgaactataccaag
actttagatttgctagaaacagttttgcgtaagatcaatttaactttttcaagattagat
ggatcaactccaaacaatgtgcgtagtaaattggttaatcagtttaacacaaatcccgat
atcaatgtgtttttgttgtcttctaaatctggggggatgggaataaacttggtaggggct
tcaagattgatattatttgacaatgactggaacccagcgacagatttgcagtcaatgtca
cgaattcatagagatggtcaggtgaaaccttgtttcatttatagattattcaccacgggt
tgcattgatgagaaaatctttcagcgacaattggtcaaaaataaattgagttcaaagttt
ttggataatgattcttcttccaaatctgatgtatttgacagtgaagatttgaagaatata
tttgagatagatacttctacaatttccaacactcatgatttattagaatgttcatgtgag
ggtgatggttccacattaagccagtctactctttctttcaaagagtctgaggagcacgac
agtgaaccccctgcgacacaagcatgggtttctgcattagaacttcaaaaaaagcttgat
aacaatgatgatgcggtgaagagaactgctgtgaaatttgccttgaacgattatcgacac
tacaatcctgaagtgaatcgtaacttagaatttgactctgccctacaaagaattgccaac
aattcaagttataaaaacaaaaaattaccaattacttttataatgctgaggataaccaat
cgagaataa

DBGET integrated database retrieval system