KEGG   Candida dubliniensis: CD36_25210Help
Entry
CD36_25210        CDS       T01140                                 

Definition
beta-N-acetylglucosaminidase, putative
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cdu  Candida dubliniensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CD36_25210
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    CD36_25210
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CD36_25210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R:44208..47090
Genome map
AA seq 960 aa AA seqDB search
MSTFYAGQLLCGGFQGTTVTPQAYHLIVEHHVSAMILSRKNAINVEQMSKLIKDLQYIAM
TEGRYTYPIMFAIDEEGGMMNSLFDPDFLTQYPGAMALAATGDPQLVYEISRAIATEIKK
IGFSIILGPVLDVVTKLSHQLVGVRSFGTTIEDVVKYGRMCARGLQDGGLFTVGKHFPGI
GNAAVDSLLELPMMGDSLEQLKHFNVVPFGELINEGLLDGISAAGCGVPNISPDETHACL
SPIVINQLLRQELRFDGFVISECLEMEALYHSVGLGQGVILAINAGCDLVMVCHDMALQN
EATDSIKKAVVNGNLDEETLIKSLKRIKKLQTRLPSWAQIFPEGEVSAKLPPTLFKNEYP
VLWEQHQQLSSLAYRKSITLIRDFDGTLPIAKHLSARGGNQVDSILLLTPLLNPIYPCKK
TDTTERLFTGEEVFQKFGDFLSNHPINKTKSYNVLHTTYTANGLTPLHESLIERSKIVIF
LTSEAGRNMYQIGIVKYVSILCGVNPQTLTKGLGPVQPRKPLIIVATSSPYDFFYNKSIG
SAYLCCYDYTDNALENLASVLMGDFEAEGCVPGEKKFLTKHKKSVAEGRTKNIHSSAHQP
KRRWLVDEFSMERDWQGLVKLLRTNNDQLTNDGFYKRLDGLLSSTSKHQKHFVVRNSSLN
ILYGIVLTWVDESKCGHLAYILVEKSKRLQSIGKNLHVRAVRYLIKERKCNEIVLGSSFP
LISLGGNISKPFFEGVGWNIQASADKNVMVLPNVDSWSVPKNILQEIMIVGVRFDICSDT
SKLRKMMERCCQSESYDAREYKNIKSLYNEAEKYLKINSPYEVKIILALEPTSQSVIGSI
VIFTSNSQLSKFYPFIDEFAEKNDPSENRSVVGGIAGPIIDPSYSNLTEIFKYGLICSAI
TFLKTSLSEEPMQCCIMTDVSTEDKAMRGVKEIGFEVWKSYHDDYGYNDVSSNVENKFGM
NT seq 2883 nt NT seq  +upstreamnt  +downstreamnt
atgtccacattttatgctgggcaactattatgtgggggatttcaaggtacaacagttacc
ccccaagcctatcatctaatcgttgagcaccatgtatcagccatgatattatcacggaag
aatgccattaatgtggagcagatgtcgaaattaatcaaggatcttcagtatattgcgatg
acagagggaagatatacgtatcccatcatgttcgccatagatgaggaaggtgggatgatg
aactcgttgtttgacccagatttcctaactcagtatcctggagcgatggcattagcagcg
acgggtgatcctcaattggtgtatgagatcctgagagcaatagcaactgaaataaaaaaa
atagggttctctattatcttgggccccgtattggatgtggtgacaaaactatcacatcag
ttggtgggagtcaggagtttcggcactactattgaagatgtagtaaaatatggacgtatg
tgtgcccgaggtttacaggatggggggttgtttaccgtggggaaacattttcctggtatt
ggaaacgctgctgttgattcattattagagctaccgatgatgggtgattctttagagcaa
ttgaagcattttaatgtggttccatttggagagttgatcaacgaagggttgttagatggg
ataagtgctgctgggtgtggtgtaccgaatattagtccagacgaaacacatgcgtgtctc
tctccgattgtgattaaccagttgctacgacaagaattgcgttttgatggatttgttatt
agtgaatgcttagagatggaggcactttaccactcggtggggttaggccagggtgtgatt
ttggcaattaatgccggctgtgatttggtgatggtgtgtcatgacatggcattacaaaac
gaagctactgattcgatcaaaaaggcggtggtcaacgggaatttagatgaagagacatta
ataaaaagcttgaaacggataaaaaaattgcagacaaggttaccaagctgggcacaaatt
ttccctgaaggtgaagtatcagctaaactaccaccaaccttgttcaaaaacgaatatcca
gtgttgtgggaacagcatcagcaactatcttcattggcttacagaaaatcaattacattg
atacgcgattttgatggaaccttacctatcgcaaagcatctaagtgctagaggtggcaac
caagttgattctattttgttgctaacgcctctactaaatcctatatacccgtgcaaaaaa
acagatacaactgaacgattgtttactggagaggaagtgtttcagaaattcggtgacttt
ttatccaaccatccaattaacaaaacaaaatcatataatgtccttcacacaacatacacc
gccaacggattgacgccactacacgagtctttaattgagcgatccaaaatagttattttc
cttactagtgaagcaggaagaaacatgtaccaaattggcattgtaaagtatgtttccata
ttgtgtggagtcaacccacagactttgaccaaaggattgggcccagttcagccacgaaag
ccgttgattatagttgccacactgtcgccctatgattttttctacaacaagagtattgga
agtgcatatttgtgctgctatgactacaccgataatgcattggagaacttggcatctgta
ttaatgggcgattttgaagcagaaggatgtgtcccgggagaaaagaagtttttgacgaaa
cacaagaaatcggtagccgaaggtagaactaaaaacatccactcaagtgcacatcaacct
aaaaggagatggttggttgatgagtttctgatggaaagagactggcaaggtttagttaag
ttattaagaacaaacaacgatcagctcacgaatgatgggttttataagaggcttgatgga
ttgttgagctcgacatcgaaacaccaaaaacactttgttgttcgtaactcttcattgaac
attctatatgggattgttttgacatgggttgatgaatcaaagtgcgggcatcttgcttac
atattagttgaaaaatcaaaacgtttgcagagcattgggaagaacttgcacgttagagca
gttagatatttgataaaggagagaaaatgtaatgaaatcgtattaggcagttcgttcccg
ttgatttcacttggtggtaatattagtaaaccatttttcgagggtgtgggttggaacatc
caagcttcagcagataagaacgtaatggttttgccaaatgtggatagttggctggtgccg
aagaatattttgcaagaaattatgattgttggcgttagatttgatatttgttctgataca
agtaaattaaggaaaatgatggaaagatgttgtcagtcagaatcttacgatgcaagagaa
tataaaaacatcaagagcctatataatgaggcagaaaaatacctcaagatcaattctcct
tacgaagtaaagatcattcttgcccttgaaccaacttcacaaagtgtcattggaagtatt
gtgatatttaccagcaattctcagttgtcaaagttttatccatttattgatgagtttgcc
gaaaagaacgatccttctgaaaatagatcagtagttggtggtattgctggtcccatcatt
gatcctctgtattcaaacctaacagagatttttaaatacgggttgatttgcagtgcaatt
acgtttttaaaaacatctttgagtgaggaacctatgcagtgttgcataatgactgatgtg
agcaccgaagataaggctatgcgcggggttaaagaaataggatttgaagtttggaagtct
tatcacgatgattacggttataacgatgtaagtagtaatgtagaaaataagtttggaatg
tga

DBGET integrated database retrieval system