KEGG   Candida dubliniensis: CD36_25270Help
Entry
CD36_25270        CDS       T01140                                 

Definition
nuclear pore protein, putative
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
cdu  Candida dubliniensis
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:cdu03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R:55389..60938
Genome map
AA seq 1849 aa AA seqDB search
MSGKFNWSSDVFADIYNTLKFETNIDLDTIDFTNIKNDLANVLITPLPSDQSRSKLGDAS
KPVALPCGDEVKLNQASIEITGVLSNELDLDELNTAELLYNASDLSYKKGTSIGDSARLA
YYLRAHYILNIVGFLVSQKRLDIITNDHQVLFDNVLKSFSRIYTLSGKLNDMIDKQKVTG
DINSLAFINCINYSRSQLFNAHELLGQVVFGLVDNYYESFGTLSNYKSLVEFISKNISDE
DIFVIHFLPLTLQLFKKLLQLGDETSVDQFYKTITSSISKDYETNNFSKSEDIDLSKSKL
SGFEIVTSFIFLTEFIPWCKQSSSRTAKYDFKDDILKYMELLISYGVMERLLSYCSETSN
VKTQQAYDWSNMYDFRALLQKNFPRLTPAKFHYPGSQELSSVVRPGYENVSKLVDISFLT
LDPSLNETLVSPFFQSFFSVFISNAAVVMTSLRDSEEDFVLSALNASDEEEEEEKEESDN
EEDSTTPRDKEKLSGLDLDKIAQRAELERFYLAFAYTYNNRSELCALFWGDERVTNDIIG
FISWGLANNTSPLITATFCMLLGTLASAGGDASSRIWEILVHNNNNTGMKKNDFSKISVD
SLYDSLKYYIDSLNESFEQDLNDQLMLSQKKQDFLFSATTSKQDLDDSGENRIVIELAED
SLVFISGFIQLLSAIVKNLNTKNERSKEIKSVIYARFSPIIKGFLKFDNLINGSRFLQVD
ANIQSSNNPKFIDLPNVYVSDDSRIILTNLILTFLGDFVDNDSDPYIRYEIWRLVDRWMY
QGLYSLAEDKKDDAFRHIKRKYISKKNVPVNQAFTTNLTHLSQIGNFAVLVKKLLTPFED
SNEAFTKYSLLYPCDLGLGYRFNNQLGIWPYIEFLMQNVFANSSTIASKRDRFNLQVNLL
ELFSNALDEIDWKFLIDVAPKIIRDLKNFNGVFDSLIPGVQLDFEVFVKLHHSVAVMNYL
FESKTFTALFGLVNIGVDSINESSESAELVSRSLCVINSLLKVQNSFINKLLPILRNKDT
QQQLHRGTTIGIGTSMSLALATPRTIFDCIYYPKNLGTHGVADFYEVILFHLPAVVQFAL
YVSCENPISTKALSILKGVSQSKFFVTTVSSSADPLLNNDRLITTFENIDESIKIKFAFI
DKFEELEDSLNMKYEILDFILGNLDQFDGKAATIAHFLLGYKVKGDTLELVQSNDQITLL
KSFLNTLSISLDLISEIDYNNGNNHIIDVGPAKLSSMILQILIKLCQDPISSSITLNQLR
EYEQLFEKLVNCQPKLDLNTVWCGNQFNGDLQIDASNVFVDNQPSTQAFFSFISQRNLIL
QYLSLEFHSVKSRTKREYYSKVLTNDKEFVNRTPKVLTFLNILNYSFKNFEVQKYEWLDR
KFNMSLILEEVNAQKNGTLDFSVLTKAFRLLCQTSNLITPESKQLFAEEIMVEGSKISDF
VTKYSVSTDLKDVQLKCLHSWCQLIEILVTDSGINSSNFILEVLQVIIPKINDYFDVDIS
FSEEMVSLCVLLFDLYDQSTLTNRKGEEFALGIERLIPLFQTCIAGILNSNSTPGLRSDL
YVVGNKFLLKCFERESFLKQMMLIIKSVDKKFFQVICNDAIYSEGPSRITSTLFLESLVH
LGTLVKVDFILNAVIKNNALSLLVRSVKRTDAMIKLCQEKNSGVTLEHFVFDLMAFKATL
YFFARVAKSKNGALQLIQNELFSILNSSKFLQIDPDIGLSLQIEEVQDHKTVNVNVLLDT
PLSITDLVDPYKLRNENNISYFEFLVPIFQLLTTVLLSMGPNYQPAIIQTKELMKSVNRL
VVGVMKRDFLVETKQIGKGLYKEESHELASLKELVKLFILIDSLANYSV
NT seq 5550 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcaagtttaattggtcactggacgtgtttgctgatatatacaacacactcaag
tttgagactaatattgatttggatacaatagatttcaccaatattaaaaatgatcttgca
aatgttttgattacaccactccctctggatcaatcacgcagcaaacttggagatgcatca
aaaccagtggcattgccctgtggagatgaagtgaaattgaatcaagcatctattgaaatc
actggagtcttatcaaatgaattggatttagatgaactaaatacggcagaattgttgtat
aacgcaagtgacttgagctacaagaaaggaacatccattggcgatagtgctcgattggct
tattatttaagagctcattatatacttaacattgttgggtttttggtttcacaaaaacgt
ttggacatcatcaccaatgaccaccaagttttgtttgataatgtcttgaaaagttttagc
aggatttacacattgagtggtaaattaaatgacatgattgataaacaaaaagttactggc
gacatcaatagtcttgcattcatcaactgtatcaattattccagaagccagttgttcaat
gcccatgaattgttgggacaagttgtgtttggattagtggataattattatgagagtttt
ggcacgttaagcaactacaaatccttagtggagtttattctgaaaaacattagcgacgaa
gatatttttgttatacattttttaccactcacattacagttgttcaaaaaattacttcaa
ctaggcgacgagacctcagtcgaccagttttataaaactataacttcttcaatactgaag
gattatgaaaccaacaatttctccaaaagtgaagatattgatttatcaaaatcaaaattg
agtgggtttgaaatagtgactagctttatatttttgacagagtttattccatggtgcaaa
caactgtcaagtaggactgccaaatacgacttcaaagatgacatattgaagtatatggaa
ttattgataagctatggggttatggaacgattgttatcgtattgttctgagactagcaat
gtaaaaactcaacaggcatatgattggtcaaacatgtatgatttcagagcgttgctccaa
aagaatttcccgagacttacgccggcaaaattccattatcctggaagtcaagaattactg
agtgtggttagaccaggatacgagaatgtctcgaaattggtggatatttcctttttgact
ttagatccatcgcttaatgagacattggtttcgccgtttttccagagctttttcagtgta
tttatatctaatgcagcagttgttatgacctctttaagagactccgaagaggattttgtt
ttgtcggcgttgaatgcaagcgatgaagaagaagaagaagaaaaagaagaaagcgacaac
gaagaggattctactaccccaagggacaaagaaaaattatccgggttagatcttgacaaa
atcgctcaacgtgctgaattagaaaggttttatttagcttttgcatacacatacaacaat
cgatctgaattgtgtgcgttgttttggggagacgagagagtaaccaatgacattatagga
tttatttcctgggggcttgctaataatacttctccgttgatcactgcaacattttgtatg
ttattaggaacattggcttctgctggtggcgatgcatcttccaggatatgggagattctt
gtgcacaataataacaacacaggtatgaagaagaatgacttttcaaagatatccgttgac
tccctatatgattcgttaaaatattatattgattcattgaatgaaagttttgagcaagac
ttgaatgatcaattgatgttgagtcagaagaaacaagattttctatttagcgccacaaca
agcaaacaggacctcgatgattctggagagaatagaattgtcatcgagttggctgaagat
tcacttgtttttatttctgggtttattcaattactttctgctattgtgaagaatttaaac
actaaaaacgaacgaagcaaagaaatcaaatccgttatatatgctagattctcaccgatc
attaaaggctttttgaagtttgataatttaatcaatggtagcagatttcttcaagttgat
gctaatattcaaagctcaaacaaccccaaatttattgatttgccaaatgtttatgtcagt
gatgattcgagaattatattgacaaaccttattctaaccttcttaggagattttgttgac
aatgatagcgatccatatattaggtatgagatttggcgtttggtcgatcgatggatgtac
caagggttgtacagtttagcagaagacaagaaagatgatgcatttagacacattaaaaga
aagtatatcagcaagaaaaacgttcctgtcaaccaagcatttacaacaaacctaactcat
cttagccagattgggaatttcgctgtgttagtgaaaaaattgttgaccccatttgaagat
agcaatgaagcatttaccaagtattcattattatacccatgtgacttgggattagggtat
agattcaacaaccaacttggaatttggccgtacattgaatttttaatgcagaatgttttt
gcaaactctagcactattgctagtaagcgagatagattcaatttgcaagtgaatttgtta
gaattgtttagcaacgcattagatgaaattgactggaagtttcttattgatgtggcacca
aaaattattcgtgacttgaaaaactttaacggagtatttgattcgcttatacctggcgtg
caattggactttgaggtgtttgtcaagttgcaccattcggttgctgtgatgaattaccta
tttgaaagcaaaacatttactgcattgtttgggcttgtcaatattggtgttgactctatc
aacgaatcaagcgagtctgctgaattggtgtcgcgttccctttgtgtgattaattctttg
ttaaaagtccagaattcttttataaacaagttgttgcctatattgagaaataaagatact
cagcaacaattacatcgtggaacaactattgggataggtacttccatgagtcttgcatta
gcaactcctagaactatttttgattgtatatactatccgaaaaatttgggaacacatggt
gttgctgatttttacgaagtgatcttgttccacttaccagcagttgtccaatttgccctt
tatgtcagttgtgaaaatccaatttccaccaaagcactttctatattaaaaggagtaagc
caatccaaattttttgtcaccacagtttcgagttctgcagatcctttacttaacaacgat
agattgatcaccacatttgaaaacattgatgaatcgataaaaatcaagtttgcctttatc
gacaagtttgaagagcttgaggactctttgaatatgaaatatgagatattggactttatt
ttgggcaatctcgatcagtttgatggtaaagcagctactattgctcattttttgttgggt
tacaaagtgaaaggtgatacattagaattggtgcagtcaaatgaccaaatcactttacta
aaatcgtttttgaatacattgagtataagtcttgatttgatttctgagattgattataat
aatggtaataatcatattattgatgttggtccagccaagctttcatcgatgattttacag
attcttatcaaattgtgtcaagatccaatttcttcatcaatcacattgaaccagttacgt
gaatatgaacaattatttgaaaaattggtcaactgtcaacctaagcttgatttgaatact
gtctggtgtggtaaccagtttaacggggatttacaaattgatgccagcaatgtatttgtt
gataatcaaccaagcactcaagcgttcttttcctttatcagccagagaaatttaattttg
caatatttgtcattggaattccatagtgtcaagtcaagaacgaaaagagaatattattca
aaagtgttgactaacgacaaggaatttgtcaatcgtacacctaaggtgttgacgttcttg
aatattctcaactattcatttaagaactttgaagtgcagaaatacgaatggcttgaccgc
aagtttaacatgtcgttgatattggaagaagtgaatgcccagaagaatggaacattggat
ttttctgtcttaacaaaggctttccgacttttgtgtcaaacatcaaatttaataactccc
gagtcaaaacaattgtttgctgaagaaattatggtggaaggaagtaaaatttctgacttt
gtaacaaagtatctggtatcaaccgacttgaaggacgtacaattgaaatgcttacattca
tggtgtcaattgattgagattttggttactgatagtggaattaattcgctgaatttcatc
ttggaagtgttacaagttattattcccaagatcaatgattattttgatgtggatattctg
ttttccgaagaaatggtttcgttatgtgttttgttgtttgatctttatgatcagctgaca
cttaccaacaggaaaggtgaagaatttgcacttggaattgagagattgattcccttattt
cagacttgtattgcaggcattcttaattctaactcaacacctggcttacgttcagacttg
tatgtggttggcaacaagtttttgctaaaatgttttgaaagagagtcatttttgaaacaa
atgatgcttattatcaagtcagtagataaaaagtttttccaggtgatctgcaatgatgct
atctactcagaaggtccttcgagaatcacgtctactttgtttcttgagtcattagttcat
ttagggactttggtgaaggttgattttattttaaatgcggtgatcaagaacaatgcattg
ctgctactagttaggtcagttaaacgaactgatgccatgatcaaattgtgccaggaaaag
aattcaggtgtgactttagaacattttgtatttgatttaatggcattcaaggcaacattg
tattttttcgctagagtggctaaatcaaagaacggggcattgcaattaattcaaaatgag
ttattttcaatattgaatctgtccaagtttttacagattgatccagatattggtttgagt
ttacagattgaagaagttcaagatcacaagactgtcaatgtcaacgttttgctagataca
ccgctttcgataactgacttggtggacccatacaagttgcgaaatgaaaataatatatct
tattttgagtttcttgtaccgatatttcagctacttacaacagtgttattgtcaatgggg
ccaaattatcaaccagcaatcattcaaacaaaagagcttatgaagagtgtcaatcggttg
gtggtgggagttatgaaaagggatttcttggtagagaccaaacaaatcggcaaaggttta
tacaaggaagagagtcacgagttggcttcgttaaaggagttggttaagttgtttattttg
attgattcattagctaattatagtgtgtag

DBGET integrated database retrieval system