KEGG   Candida dubliniensis: CD36_25740Help
Entry
CD36_25740        CDS       T01140                                 

Definition
acetyl-CoA carboxylase, putative (EC:6.4.1.2)
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
cdu  Candida dubliniensis
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cdu01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cdu00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cdu00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:cdu00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R:165377..172063
Genome map
AA seq 2228 aa AA seqDB search
MSDQSPSPSPSPSDSLSYTTLHESLPPHFLGGNSVLNAEPSKVKDFVRAHQGHTVISKIL
IANNGIAAVKEIRSVRKWAYETFGDEKAIQFTVMATPEDLEANAEYIRMADQFIEVPGGT
NNNNYANVDLIVEIAESTNAHAVWAGWGHASENPLLPEKLAASPKKIIFIGPPGSAMRSL
GDKISSTIVAQHAQVPCIPWSGTGVDEVKIDPETNLVSVADDVYAKGCCTSPEDGLEKAK
KIGFPVMIKASEGGGGKGIRKVDDEKNFITLYNQAANEIPGSPIFIMKLAGDARHLEVQL
LADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIARKETFHEMENAAVRLGKLVGYVSAGT
VEYLYSHAEDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPMHRIRDIRTLYG
ADPHTTTNIDFEFKSETSLVSQRRPTPKGHCTACRITSEDPGEGFKPSGGSLHELNFRSS
SNVWGYFSVGNQSSIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFRTTVEYL
IKLLETPDFEDNTITTGWLDELITKKLTAERPDPIVAVVCGAVTKAHIQAEEEKNEYIQS
LEKGQVPHKNLLKTIFPVEFIYEGERYKFTATKSSEDKYTLFLNGSRCVVGARSLSDGGL
LCALDGKSHSVYWKEEASATRLSVDGKTCLLEVENDPTQLRTPSPGKLVKYLVDSGEHVD
AGQPYAEVEVMKMCMPLIAQENGVVQLIKQPGSTVNAGDILAILALDDPSKVKHAKPFEG
TLPAMGEPNVTGTKPAHKFHHYAGILKNILAGYDNQVILNSTLKSLGEVLKDKELPYSEW
QQHISALHSRLPPKLDDGLTALVERTQSRGAEFPARQILKLITKAIHENGNDMLEDVVAP
LVSIATSYQNGLIEHEYDYFASLISEYYDVESLFSGENVREDNVILKLRDENKSDLKKVI
GIGLSHSRVSAKNNLILAVLDIYEPLLQSNSSVAGSIREALKKLVQLDSRACAKVALKAR
EILIQCSLPSIKERSDQLEHILRSSVVQTSYGEIFAKHREPNLEIIREVVDSKHIVFDVL
SQFLINPDPWVAIAAAEVYVRRSYRAYDLGKIEYHVNDRLPIVEWKFKLASMGAAGVNDA
QQAAVAGGDDSTSMKHAASVSDLTFVVDSKTEHTTRTGVLAPARHLDDVDETLTAALEQF
QPADAISFKAKGEAPELLNVLNIVITSIDGYSNENEYLSRINEILCEYKEELISAGVRRV
TFVFAHQIGQYPKYYTFTGPDYEENKVIRHIEPALAFQLELGRLANFDIKPIFTNNRNIH
VYDAIGKNAPSDKRFFTRGIIRTGVLKEDISISEYLIAESNRLMNDILDTLEVIDTSNSD
LNHIFINFSNAFNVQASDVEAAFGSFLERFGRRLWRLRVTGAEIRIVCTDPQGTSFPLRA
IINNVSGYVVKSELYLEVKNPKGEWVFKSIGHPGSMHLRPISTPYPVKESLQPKRYKAHN
MGTTYVYDFPELFRQATISQWKKYGKKVPKDVFVSLELITDETDSLIAVERDPGANKIGM
VGFKVTAKTPEYPHGRQLIIVANDITHKIGSFGPEEDNYFNKCTELARKLGIPRIYLSAN
SGARIGVAEELIPLYQVAWNEEGSPDKGFRYLYLSTAGKESLEKDGKGGSVVTERIVENG
EERHVIKAIIGADDGLGVECLKGSGLIAGATSRAYKDIFTITLVTCRSVGIGAYLVRLGQ
RAIQIDGQPIILTGAPAINKLLGREVYSSNLQLGGTQIMYNNGVSHLTANDDLAGVEKIM
EWLSYVPAKRGLPVPILESEDSWDRDVDYYPPKQEAFDVRWMIQGREVDGEYESGLFDKD
SFQETLSGWAKGVVVGRARLGGIPIGVIGVETRTIENLIPADPANPDSTENLIQEAGQVW
YPNSAFKTAQAINDFNNGEQLPLMILANWRGFSGGQRDMYNEVLKYGSFIVDALVDFKQP
IFTYIPPNGELRGGSWVVVDPTINSDMMEMYADVDSRAGVLEPEGMVGIKYRRDKLLATM
ERLDPTYGDLKAKFNDSSLSPEEHSKVSAKLFAREKALLPIYAQISVQFADLHDRSGRML
AKGVIRKEIKWTDARRFFFWRLRRRLNEEYVLRLISEQIKDASKLERVARLKSWMPTVEY
DDDQAVSNWIEENHTKLQKRVNELKQEVSRTKIMRLLKEDPNSAISAMKDYVEGLSKEDK
EKFLKALK
NT seq 6687 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatcaatctccttctcctagccctagtcctagcgattcccttagttatactaca
ttacatgaaagcttaccacctcattttttgggtggaaactcagttttgaatgctgagcct
tctaaagttaaagactttgtcagagctcatcaaggtcatacagttatttctaagatttta
attgccaacaatggtatagctgcagttaaagaaattagatcagttagaaaatgggcttat
gaaacatttggtgatgaaaaagccatacagttcaccgttatggccactccagaggatttg
gaagctaatgccgaatacattagaatggccgaccaattcattgaagtccccggtggcacc
aataacaataactatgccaacgttgatctcattgtagagatagcagaaagcacaaatgct
catgctgtttgggctgggtggggacatgcttccgaaaaccctttgttgccagaaaaatta
gctgcctctcccaagaagattatttttattggacctcctgggtcagctatgagatcttta
ggtgataagatttcatctactatagttgctcaacatgcccaagtaccatgtattccatgg
tctggtactggtgttgatgaagtgaaaatagatccagaaactaatttggtttctgttgct
gatgatgtttatgccaaaggatgctgtactagtccagaagatggtttagaaaaagccaag
aaaattgggttcccagtcatgattaaagcttctgaaggtggtggtggtaaaggtattaga
aaagtcgatgatgagaagaatttcattaccttgtacaatcaagcagctaatgaaatacca
ggttctcctatttttatcatgaagttggctggtgatgccagacatttggaggttcaatta
ctagctgatcagtatggtaccaacatttcactttttggaagagattgttccgttcaaaga
agacatcaaaagattattgaagaggcaccagtcaccattgccagaaaggaaactttccac
gaaatggagaacgctgcagtcagattgggtaaattagttggttatgtatctgctggtacc
gttgaatatctttactcccatgctgaagacaaattttactttttggaattaaacccaaga
ttgcaagttgaacatccaaccactgaaatggtaacaggggtaaatttaccggctgctcaa
ttacaaattgctatgggtataccaatgcatcgaatcagagatatcagaactttgtatggt
gctgatccacataccacaactaatattgattttgaatttaaatcagagacctcattggtc
agtcaaagaagaccaacaccaaaggggcattgtactgcttgtcgtattacttctgaagac
ccaggtgaaggttttaaaccaagtggtggttctttacatgaattgaatttccggtcctct
tccaatgtgtggggttatttctcagtgggtaaccaatcttctatccattcattctcggat
tctcaatttggtcatatttttgcctttggtgaaaatcgtcaagcttcaagaaaacatatg
gttgttgctttgaaagaattaagtattagaggtgattttagaactacagttgaatattta
atcaaattgttagaaactccagatttcgaggataacaccattacaactggttggttagat
gaattaatcaccaagaagttgactgcagaaagaccagatccaatagttgctgttgtttgt
ggagctgtaactaaagctcatattcaggccgaggaagagaaaaacgagtacatccaatct
ttggaaaaaggtcaagttcctcacaagaatttattgaaaactattttccctgttgaattt
atttatgaaggtgaaagatacaagttcactgctaccaaatcctcagaagataaatatact
ttgttccttaatggttctcgttgtgttgttggtgcacgctcattgtcggatggtggttta
ttatgtgcattagacgggaaatcacattctgtgtactggaaagaagaggcatcagccact
agattatctgttgatggtaaaacttgtttattggaagttgaaaatgatccaacacaatta
agaactccatctccaggtaaattggtcaagtatttggttgacagtggtgaacatgttgat
gcaggtcagccatatgccgaggttgaagtgatgaaaatgtgtatgcctttgattgctcaa
gaaaatggggtggtacaattgattaaacaaccaggttcaacagttaatgctggtgacatc
ttggccattttggcattggatgatccatctaaggtcaagcatgctaaaccatttgaaggt
actttgccagccatgggtgagccaaatgttacaggtaccaagccagcacacaagttccat
cattatgctggtattttgaagaatatcttggcaggttatgataatcaagtgattttgaac
tctactttaaagagtcttggtgaagttttgaaagacaaggaattgccatactccgaatgg
caacagcacatttcagctttacattccagattgccacctaaattggatgatggattaact
gcattggtcgaaagaactcagagtagaggagctgaattccctgctcgtcaaattttaaaa
ctcatcaccaaagcaattcatgaaaatggtaatgatatgttagaggatgtggttgcacca
ttggtttcaattgccacaagttatcaaaatggtttgattgaacatgaatacgattacttt
gcatctttgattagcgaatattatgatgttgaaagcttattttctggtgaaaatgtcaga
gaagataatgttattttgaaattgagagatgaaaacaaatctgatttgaagaaagttatt
ggtattggtttgtctcattcacgtgttagtgccaaaaacaatttgatattggccgtttta
gacatatatgaaccattgttgcaatccaattcatccgttgctggttctattagagaagct
ttgaaaaaacttgttcaattggattctcgtgcttgtgctaaagttgcattaaaagccaga
gaaattttgatccaatgttcattaccttccatcaaggaaagatctgatcaattggaacat
attttgagatcatctgttgttcaaacctcgtatggtgaaatttttgctaaacatagagaa
ccaaatttggaaattattcgtgaagttgttgattccaaacacattgtttttgatgtgttg
tcacaatttttgatcaatccagatccatgggttgccattgctgcagctgaagtgtatgtc
agacgttcataccgtgcttatgatttgggtaaaattgaatatcatgttaacgacagactt
cctattgttgaatggaaattcaagttagctagtatgggagccgctggagtaaatgatgct
caacaggctgctgttgctggtggtgatgactcaacatcaatgaaacatgctgcttcagtt
tctgatttgacctttgttgttgattccaaaaccgagcatactacaagaactggtgtgtta
gctcccgcaagacacttggatgatgttgatgaaactctcacagctgcattggaacaattt
caaccagctgatgctatttcattcaaagcaaagggtgaagctccagaattattaaacgtt
ttgaacattgtcattactagcattgatggttattccaatgaaaatgaatacttgagcaga
attaatgaaatcttgtgtgagtacaaagaagagttgatatctgctggtgtacgtcgtgtt
acttttgttttcgcacatcaaattggtcaatatcctaaatactatacttttactggtcct
gattatgaagaaaataaagttattagacatattgaacctgctttagctttccaattggaa
ttgggaagattggccaatttcgacatcaagccaattttcactaacaacagaaatatccat
gtatatgatgcaattggtaaaaacgcaccttctgataagagatttttcaccagaggtatt
atcagaaccggtgttctcaaagaagacattagcattagtgaatacttgattgctgaatct
aatagattaatgaatgatattttggatacattggaagtcattgatacttctaattctgat
ttgaatcacattttcattaatttttcaaatgctttcaatgttcaagcatcagatgttgag
gctgcctttggatcatttttagaaagatttggtagaagattatggagattaagagttact
ggtgccgagattagaattgtttgtactgatcctcaaggtacttctttcccattacgtgct
atcattaataatgtctctggttatgttgtgaaatcagaattgtatttggaagttaaaaac
cctaaaggtgaatgggttttcaaatccattggtcatccaggttccatgcatttgagacct
atctcgactccatatccagtcaaagaatctttgcaacctaaacgttacaaagctcacaat
atgggtactacatatgtctatgatttcccagaattattccgtcaagcgactatttcacaa
tggaaaaaatatggtaagaaagtaccaaaagacgtttttgtatctttagagttgatcact
gatgaaactgattccttgatagctgttgaaagagacccaggtgcaaataaaattgggatg
gttggattcaaagtcactgctaaaacccctgaataccctcatggtcgtcaattaattatt
gttgccaatgatattactcacaagattggttcatttggtccagaagaagataattacttc
aacaagtgtactgaattggcaaggaaattgggtattccaagaatttacctttctgcaaac
tcaggtgctagaattggtgttgctgaagaattgattccattataccaagttgcctggaat
gaagaagggtctcctgacaagggatttagatacttgtatttgagcactgctggtaaagag
tctttagagaaagatggcaaaggtggcagtgttgttactgaacgtattgttgaaaacggt
gaagagcgtcatgttattaaagctattattggtgctgatgatggtttaggggttgaatgt
cttaaaggatctggtttgattgctggtgccacttcaagggcttacaaagatatattcact
atcactttggtaacttgtagatccgttggtattggtgcatacttggttagattgggtcaa
agagcaattcaaatcgacggtcaacctattattttaactggggctcctgctatcaataaa
ttattgggtagagaagtgtattcctcaaatcttcaattgggaggtactcaaattatgtat
aataatggtgtttctcatttgactgctaatgatgatttggctggggttgaaaagattatg
gaatggttatcgtatgttccagctaagcgtggcttgccagttccaattttggaatcagaa
gactcttgggatagagatgttgattactatccaccaaaacaggaagcctttgatgttaga
tggatgattcaaggtagagaagtcgatggtgaatatgaatctgggttatttgataaagac
tcattccaagaaacattgtctggttgggctaaaggtgttgttgttggtagggcacgtttg
ggtggtattccaattggtgtgattggtgtcgaaacaagaacaatagaaaacttgattcct
gccgatccagcaaatccagattctacagaaaatttgatccaagaagctggtcaagtgtgg
tatcctaactctgctttcaagacagcacaagctataaatgatttcaacaatggtgaacaa
ttgccattaatgattttagcaaattggagaggtttttccggtggtcaaagagacatgtac
aatgaagtcttgaaatatggttcatttattgttgacgctttggttgatttcaaacaacct
attttcacttatattccaccaaatggagaattgagaggtggttcatgggttgttgttgat
ccaactattaactcagatatgatggaaatgtatgctgatgtcgattcaagagctggtgtt
ttggaaccagaaggtatggttggtatcaaatatagacgtgataaattattggcaactatg
gaaagattggacccaacttacggtgacttgaaagccaagtttaacgattcatcgttgtct
ccagaagaacattcgaaagtaagtgctaaattgtttgctcgtgaaaaggctttgttacca
atttatgctcaaatttctgttcaatttgctgacttgcacgatagatctggtcgtatgttg
gccaagggagttattagaaaggaaatcaaatggactgatgctagacgtttcttcttctgg
agattaagaagaagattgaatgaagaatatgttttgagattgatcagtgaacaaatcaaa
gatgctagcaagttggaaagagttgctagattaaagagttggatgccaactgttgaatac
gatgatgatcaagctgtcagtaattggattgaagagaaccatacaaaattacaaaagagg
gttaatgaattgaaacaagaagtttcaagaaccaagattatgagattattaaaagaggat
ccaaatagtgcaatctctgccatgaaggattatgttgaagggttatccaaagaagataaa
gagaaattcctcaaggcattaaagtag

DBGET integrated database retrieval system