KEGG   Candida dubliniensis: CD36_25850Help
Entry
CD36_25850        CDS       T01140                                 

Definition
(RefSeq) glycogen [starch] synthase, putative
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
cdu  Candida dubliniensis
Pathway
cdu00500  Starch and sucrose metabolism
cdu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CD36_25850
Enzymes [BR:cdu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     CD36_25850
Glycosyltransferases [BR:cdu01003]
 Polysaccharide
  Storage polysaccharide
   CD36_25850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_transf_4 DUF1978
Motif
Other DBs
NCBI-GeneID: 8050088
NCBI-ProteinID: XP_002421682
UniProt: B9WKS1
Position
R:complement(192512..194497)
Genome map
AA seq 661 aa AA seqDB search
MARDIDNHLLFEVATEVAHKVGGIYSVLKSKAPVTVAEYRERYTLLGPLHYDSAQIEVEE
LPVTDPHIKQTLDSMSSKGIRWLYGRWLIEGAPRVLLFDIWSAGHYLNEWKADLWNVAGI
PTPDHDSETNDAILLGYLVAWFLGELVYNDRDRAVICQCHEWLAGIALPLCRKRRIDVTT
IFTTHATLLGRYLCAGSTDFYNNLDKFDVDAEAGKRGIYHRYCIERSATHSADVFTTVSD
ITAYEAEHLLKRKPDGVLPNGLNVVKFQAVHEFQNLHAIKKAKINEFVKGHFYGNYDFDL
DNTLYFFIAGRYEFRNKGCDFFIESLARLNHKLKEAGSKTTVVAFIIMPGKTQSYTVETL
KGQAVVKQLESTIGEVQKKVGERLFEYCARYPNADHQGNDEVPTIDELIKPADRVLLKRR
IFALKRDGLPPIVTHNMVDDSTDPVLNHIRRVQLFNKPEDRVKIIFHPEFLNANNPILSL
DYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSITTNLSGFGCYMNDLVENPTDYGIY
IVDRRMKSVDESINQLTDYMFDFCAKSRRQRINQRNRTERLSVLLDWRSVHSEYSKARLL
ALKRAYPDYVGEKVVESKMKITRPMSVPGSPRSLLLTPGDLGSLQDANQDISYFELGEEE
S
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggctagagatattgataatcatttattatttgaagttgccactgaagtagctcataaa
gttggaggtatttactccgttttgaaatcaaaagcccctgtcactgtagctgaatatcgt
gaacgttacactttgttgggtcccttacactatgactcagcacaaattgaagttgaagaa
ttgccagttaccgaccctcatattaaacaaacccttgattctatgtcttctaaaggtatt
agatggctttatggtagatggttaattgaaggtgcgccaagagtgttattatttgatatt
tggtcagctggtcattatttgaatgaatggaaagccgatttatggaatgttgcaggtatt
cctacccctgaccatgacctggaaaccaatgatgctattttgttgggatatttggttgct
tggtttttaggtgagttggtttacaatgaccgtgatcgtgctgttatttgtcaatgtcat
gaatggttagcaggtattgcgttgccattatgtagaaagagaagaattgatgttaccacc
attttcaccacccatgcaacattattgggaagatatttgtgtgctggtagtaccgatttc
tacaacaatttagacaagtttgatgttgatgctgaagctggtaaaaggggtatttatcac
cgttactgtattgaaaggtctgctacacattcggctgatgtcttcaccaccgtttccgat
attactgcctatgaggcagagcatttgttgaaaagaaaaccagacggggttttgcccaat
gggttgaatgtcgtgaaattccaagcggttcacgagttccaaaatttgcatgccattaaa
aaggccaagattaacgaatttgtcaaaggacatttctatggtaactacgattttgattta
gataatactttatatttcttcattgctggtagatatgagtttagaaataaggggtgtgat
ttctttattgaatccttggctagattgaatcataagttgaaagaggcaggttccaaaacc
acagttgtggctttcattattatgccaggaaaaactcaatcttacaccgttgagactttg
aaaggtcaagctgttgttaaacaattggagtcaaccattggagaagtacaaaagaaagtt
ggtgaaagattatttgaatattgtgctagatatcctaatgctgaccatcaaggaaacgat
gaagtgccaactattgatgagttgattaaaccagctgacagagttttgttgaaaagacgt
atatttgcattgaagagagacggtttgccaccaatcgtcacccacaacatggttgacgac
agtactgatccagtcttgaaccatatcagaagagtccagttatttaacaaaccagaggat
agagtaaagattattttccatccagaattcttgaatgctaacaaccctattttatcatta
gattacgatgaatttgttagagggtgccatttgggtgtgttcccgtcctactatgaacct
tggggttacactccagctgagtgtactgtcatgggtataccttctatcaccaccaattta
tctggatttgggtgctacatgaatgatttggttgaaaacccaaccgattatggtatttac
attgttgacagaagaatgaagtctgtcgatgaatctatcaatcaattgactgattacatg
tttgatttctgtgcgaaatccagaagacaaagaatcaaccaaagaaatagaactgagaga
ttgagtgttcttttggattggagatcagttcattcggaatattccaaggctcgtttgttg
gcacttaaaagagcttatcctgattatgttggtgagaaagtagtcgagtcaaagatgaaa
atcactagaccaatgtcagttcccggttctccaagaagtttgttactcacgccaggtgat
cttggctcattgcaagacgctaatcaagacattagttattttgaattaggcgaagaagaa
tcctaa

DBGET integrated database retrieval system