KEGG   Candida dubliniensis: CD36_26240Help
Entry
CD36_26240        CDS       T01140                                 

Definition
anaphase-promoting complex subunit, putative
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
cdu  Candida dubliniensis
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    CD36_26240
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    CD36_26240
   04113 Meiosis - yeast
    CD36_26240
Protein phosphatases and associated proteins [BR:cdu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CD36_26240
Ubiquitin system [BR:cdu04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     CD36_26240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R:complement(293593..296166)
Genome map
AA seq 857 aa AA seqDB search
MHSTTTGAGGRSGSRSRSTSAAGAGATTTSSSTARILGPTLFQDETNSSANPKYIQQYLR
SIIIHSLDTLNYQNAEFASERLLALMEQQRDQQISQQQNHHQQQQQQQQQQQRDEESDDF
LDSMYLYCLVLYRQDKYKTCYFKLSNLKKFDHHLSCSFLYGKCCLKLNKFKEGIFHLIKT
KKYHDINNTNNTSKFSGTNTSNNNDRFNKFNYEYNRNISSDISSIYHILGDLYREVNDLK
NSCMNYTLCLKLNQFDFEAFQKLCKLGVNIRVKSIFKFQHQPYSKNNINNAFTSANANSH
ANNEGPTIPDLTNPFTDRSFNSKLTPSIHVDEFNFSTPRVKTTNASTSSDAPLRKSNLNN
GSTVNTNSNNGGGTGHTNNPNSIAAAAAAATAATASTTNNSNTNHDFEFTKPNYPDDKRK
SQSTYSRITSRLISQPQNHHHHHHHQQQQQQQQQTGSSQMETPKKRNLKRNNSATLDPMY
QQGTSASNSTANSISGIGGATSPATSSSTASASSRSSSSSIIITKEIEKSEKHLLQLYLN
LGKSYRSMCKYDCYKAIRMLETSLNEFEKNTPWVLSKLGRLHYEIVNYPQSEFYFTKLRR
LDRTRLQDMEYYSTLLWHLNKKVELTYLANELHDLQPNAAITWCVIGNLFSLIHEPNESI
KCFNRAIKLDKKFTYAYTLKGHEYFSNDNYEMALENFRISLLLDPRHYNALYGLGMIYIN
LGDYEKADYHFRKAISINPINIILICCCGMVLEKLNKRTLAIKQYELAHKLQPLNPLPIF
KLGQLYFSLKNYSLALKNFEILKNLAPNEASVHFLLGQLYNLQNDKFLAIKEFTVALNLD
PKGNYLIREAMESLKKS
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgcattctactacaaccggagcaggaggaagatcaggatcaagatcaagatcgacctca
gcagcaggagcaggagcaacaaccacgtcatcatcaacagcaagaatattaggtcctact
cttttccaagatgaaactaattctagcgctaaccccaaatatattcaacaatatttaaga
tcgattatcattcattcattagatacattgaattatcagaatgccgaatttgccagtgaa
agattattagctttaatggaacaacaacgtgaccaacagatatcacaacagcagaatcac
caccaacaacaacaacaacaacaacaacaacaacaaagagatgaagaaagcgatgacttt
ttagactcaatgtatttatattgtcttgttttataccgacaagataaatataaaacttgt
tattttaaattgagtaacttgaaaaagtttgatcatcatttaagttgttcatttctttat
ggtaaatgttgcttaaaattgaataaattcaaagaaggaatatttcatttaattaaaact
aagaaatatcacgatataaataatactaataacacgtctaaattttctggcacaaacaca
agcaacaacaatgaccgatttaataaattcaattatgaatacaatcgtaacatcagttca
gatatatcactgatttatcatatattgggtgatttatatcgggaggtaaatgatttgaag
aatagctgtatgaattatactttatgtttgaaattaaatcaatttgattttgaagcattt
caaaaattatgtaaattgggagttaatattagggtcaaatcaattttcaaatttcaacat
caaccatatagtaaaaataatattaataatgcattcacaagtgcaaatgcaaactcacat
gcaaacaatgaaggtccaacaatacctgatttaacgaatccatttactgatagatcattc
aactcaaaactaaccccatctattcatgttgacgaatttaatttttcaacaccaagagtg
aaaactacgaatgctagtacaagttctgatgccccattacgcaaatcaaatttaaacaat
ggatcaacagtgaatacaaattcaaacaatggcggtggtactggtcataccaataatcct
aattctattgctgctgcagctgcagctgctaccgctgccacggctagtacaacaaataat
agcaataccaatcatgattttgagtttaccaaacctaattaccccgatgataaaagaaag
agtcaaagcacttattcaagaataacgtcaagattaatttctcaaccgcaaaaccatcac
catcaccatcaccaccagcaacaacaacaacaacaacaacaaacaggatcttcacagatg
gaaacacccaaaaagagaaatttgaaacggaataactcggcaacattagatccaatgtat
caacagggcacttcagcatctaattcaactgcaaattcaatttcaggaataggtggtgca
acatcaccagcaacgtcatcttctactgcctcggcatcttcacgatcttcatcgtcctct
atcataatcaccaaagagattgaaaaaagtgaaaaacaccttttacaattatatttgaat
ttagggaagagttatcgaagcatgtgcaagtatgattgctacaaagccataagaatgttg
gaaacgtctttgaatgaatttgagaaaaatacaccgtgggttttgagtaaattagggaga
ttacattatgaaattgttaattatcctcaatcggaattttatttcactaaattaagaaga
ttggaccgcactcgtttacaagatatggaatattatctgacgttattgtggcatttgaat
aaaaaagtagaattgacttatttagccaatgaattacatgatttacaacctaatgctgcc
atcacttggtgtgttataggtaatttattttcattaatccatgaacccaatgaatcaatc
aaatgtttcaatagagcaattaaattggataaaaaatttacttatgcttacacattaaaa
ggtcatgaatattttagtaatgataattatgaaatggcattagagaatttccggatcagt
ttattattagatcctcgtcattataatgccttgtatggtttaggtatgatctatatcaat
cttggtgattatgagaaagccgattatcatttccgtaaagcgatttctattaatccaatc
aatataattttgatttgttgttgtggtatggtgttggaaaaattgaataaacgaacttta
gccattaaacaatacgaattagcccataaattacaaccattaaatccattaccaattttt
aaattgggtcaattatattttagtttgaaaaattatctgttggcattgaaaaatttcgaa
atattgaaaaatttagctcctaatgaagcaagtgtccatttcttattaggacaattgtat
aatttacaaaatgataaatttttggcgattaaagaattcacagttgctttgaatttagat
ccaaagggtaattatttaattcgtgaagccatggaatcattgaaaaaaagctga

DBGET integrated database retrieval system