KEGG   Candida dubliniensis: CD36_26500Help
Entry
CD36_26500        CDS       T01140                                 

Definition
histone acetyltransferase, putative (EC:2.3.1.48)
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
cdu  Candida dubliniensis
Brite
Enzymes [BR:cdu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CD36_26500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R:356404..358791
Genome map
AA seq 795 aa AA seqDB search
MVSHLLNQLKITNNHIYSNIVPQDLDKRTIRVKPTNDYSLKSMIKKNTHQKPTITKTNSI
TKIRPVQDNNSIKRGNRNFRNGNVFVKLTKKKYIVVINYDKTKLSTTTTTIRSKSGVIPS
LLPHSASYKPETQFDTSLSSEIPLPYKGILKYPDCVINNTDPTKLDTERFNKFLNEGIVL
RNKTTSHCEIESPASSNLPNQLINESNQSTESTPVPSFSNLNKSKINRIVLRDFEINTWY
IAPYPEEYSQCEVLYICEYCLKYMNSPMSYRRHQLKNCNFSNNHPPGLEIYRDPKNKISI
WEVDGRKNISYCQNLCLLAKLFLNSKTLYYDVEPFIFYVLTEIDEKNPSNYHFVGYFSKE
KLNSSDYNVSCILTLPIYQRKGYGNLLIDFSYLLSRNEFKYGTPEKPLSDLGLLSYRNYW
RVTIAYKLKQIYDKYLANNANGDSNNSRLSLSVDILCKLTGMIPSDVIVGLEQLDSLVRN
PLTHTYAIVINLEKINTEIAKWEKKSYTKLDYEKLLWKPMLFGPSGGINSAPSLQPQSHP
EQPGTTMSTGEGAVAVHSKPVIPQNSISLITNFLKDDINNPYTFEEEGFKEIEAHRETEN
DEIKNASLVEYVTCYPGIVVNNHISSGSGGGGGGSGGGSGSESNGSNGQTKSNEKVFKKS
KKFTVEDDEIEEIFEIDELSSNDENEPDFENDDNDNDNDEEEEEEDELDDFVDDDEVMEI
KENYSDEDVSEDIIELIDDDDDDEDDEEDWGRTWKRRAPSPPKRKTANVLASNRKPRSRG
RPRGTFKLKPQDLGP
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggttctgcacctactaaatcaattaaagattaccaataatcacatatattcaaatata
gtgcctcaagatttggataagagaaccattcgagtcaagcctaccaatgactattctttg
aaaagtatgataaaaaagaatactcatcaaaaaccaacaataacaaagacaaactccatc
accaaaataagacctgttcaggataataatagtatcaaaagagggaatagaaattttagg
aatggaaatgtttttgtgaagttaacgaaaaagaaatatattgttgttattaattatgac
aaaacaaagctatcaacaacgacaacaacaataagatcaaagtcaggagtaataccactg
ctactacctcatagtgcatcctacaaaccagaaactcaatttgatacatctttgtcgtcg
gaaataccattaccttataaaggaatattaaagtaccctgattgcgttatcaataacact
gaccccacaaaactagatacagaaaggtttaacaaatttcttaatgaaggaatagtatta
cgaaacaaaaccacaagccattgtgaaatagaatcaccggcctcatctaatttacctaat
caattaataaacgaatcaaatcaaagtacagaatctactccggtgcctagtttttcaaat
ttaaacaaatccaaaataaatcggatagtactaagagattttgaaatcaacacttggtat
attgctccatatccagaagaatattctcaatgtgaagtattatacatttgcgagtattgt
ctcaaatatatgaattcgccaatgtcatatcgacgacatcaattgaaaaattgtaatttt
tcaaacaatcatccaccaggattagaaatttatcgtgatccaaaaaataaaattctgatt
tgggaagttgacggaaggaaaaatatcagctattgtcaaaatttatgtttattagccaaa
ttattcctcaattccaaaactttgtattatgatgtggaaccatttattttttatgtatta
acggaaattgatgaaaaaaatccttcaaattatcactttgttggatattttctgaaggaa
aaattgaacagttctgattataatgtttcatgtattttaactttaccaatttatcaaaga
aaagggtatgggaatttattgattgatttcagttatttattaagtcgaaatgaattcaaa
tatggaactcctgaaaaaccactcagtgatttgggcttattaagttatagaaattactgg
agagtaacaattgcttataaattgaaacaaatttacgataaatacttggcaaacaatgcc
aatggcgatagcaacaattcaaggctaagtctatcggttgatatactatgtaagttgact
ggtatgataccgtccgatgttattgtggggttagagcaattggattcattagtaagaaat
ccattaactcatacttatgccattgtgataaacttggagaaaataaacactgaaattgcc
aaatgggaaaagaaactgtacactaaattagactatgagaaattattatggaaaccaatg
ttatttggtcccagtggtggaatcaattctgcaccatcacttcaaccacaatcacatcca
gaacaaccaggaacgacaatgtcaactggagaaggtgctgtagcagttcattcaaaacca
gtaatcccccaaaatagtatttctttaataacaaactttttgaaagatgacatcaataat
ccttacacatttgaagaagaaggttttaaagaaattgaagctcacagagaaacagagaat
gacgaaataaagaatgcaagccttgtggaatatgttacatgttatccaggaatagtagta
aacaatcatattagtagtggtagtggtggtggtggtggtggtagtggtggtggtagtggc
agtgaactgaatggttcaaatggtcaaactaaaagtaatgaaaaggtgttcaagaaaagc
aaaaaatttaccgtcgaagatgatgaaattgaagaaatatttgaaattgatgaactttca
agtaatgatgaaaatgagccggattttgaaaacgatgacaatgacaacgacaacgacgag
gaggaggaggaggaggatgaattggatgattttgtggatgacgatgaggtaatggagatc
aaagagaactattctgatgaggatgtttctgaagatataattgagcttattgacgatgat
gatgatgatgaggatgatgaagaggattggggaagaacttggaagcgaagggcaccatca
ccgcccaagagaaaaactgccaatgtattggctagtaacagaaaaccaagaagtagaggg
agaccaagaggaacattcaaattaaaacctcaagatttgggaccataa

DBGET integrated database retrieval system