KEGG   Candida dubliniensis: CD36_29180Help
Entry
CD36_29180        CDS       T01140                                 

Gene name
STE7
Definition
serine/threonine-protein kinase, putative (EC:2.7.12.2)
Organism
cdu  Candida dubliniensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R:873898..875649
Genome map
AA seq 583 aa AA seqDB search
MTRTTRIDTQEATKHKDLPPVPSTSLSSNSEYLMESKSLGRKNFKKLSLDASPVKSTSNN
LRSSDMMSIKEPTSLRQKRQRPPPMLHLPTSSSSTTSTPTSNITGTSSASSVHFSQKSPG
SGVIVSQTLSRPSSAGGMGSSGYSALNINQSNRNVDPDNVVSTDMILNQISNLDLTSMNH
HRQNSHHHLPSTNRKRQTVISSISPTKSSASSSPLEPQNQSLPASSQSPIATTSALKLNN
KDLLTLKQLGSGNSGSVSKILHIPTQKTMAKKIIHIDSKSVIQTQIIRELRILHECHSPY
IIEFYGACLNNNNTIVICMEYCNCGSLDKILPLCENRQFPTFVLKKLSFAILSGLTYLYT
THKIIHRDIKPNNVLMTHKGEFKLCDFGVSRELTNSLAMADTFVGTSMYMSPERIQGLDY
GVKSDVWSTGLMLIELASGVPVWSEDNSNNDDDDEDGDDGCSGQGILATERNGQNSPSKS
RKKNQKGNGYNSYNGPEGILDLLQRIVNEDAPTLTNKINPVTKLPYDKYLCQFIDLCLIK
DDSVRKTPWQLLEDKEHFFKGVEEGAYDKEHKSWAKKIRKCKV
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgacaagaacaactcgtatagatacacaagaagctacaaagcataaggatttaccacca
gtgccttcaacatcattatcatcgaattcagaatacctaatggaatccaaaagtctagga
cgaaaaaacttcaaaaagctttctctagatgcatctccagttaaatcaaccagcaacaac
ctaaggagttctgatatgatgctgataaaggaaccaacttctttgcgacaaaagagacag
cgtcctccacctatgcttcacttacccacatcgtcttcatctaccacatctactccaaca
tccaatattacaggcacttcatcagcttcttctgtgcatttttcacagaaatcccctggg
tcaggtgttattgtaagtcaaacattaagccgaccttcaagtgctggcggtatggggtct
tctggttactcggcattgaatatcaatcagagcaataggaatgtcgatccagataacgtg
gtttcaacagatatgatattaaaccaaatatctaatttagatttaacaagtatgaaccat
catcgccaaaatagtcatcaccaccttccatcaactaatcgtaaacgtcaaactgtcatt
tcttcaatatcaccaacgaaatcatcagcatcatcatcaccattggagccacaaaatcaa
ctgttacctgcttcatcccagtctcctattgccaccactagtgcattaaagttgaacaat
aaagatttattgacattaaaacagttgggttcaggaaactctgggtcagtgctgaagatt
ttacacatacccacacaaaaaaccatggcgaagaaaatcatccatattgatctgaaaagt
gtgatacaaactcaaataatccgtgaattaagaatactacacgaatgccattctccttac
atcatcgaattttatggggcttgtttaaataacaataacactattgtcatctgtatggaa
tattgtaattgtggatcattggataaaatattgcctctttgtgagaatagacaattcccc
acttttgttttgaaaaaactatcatttgccattttatctggattaacgtatttatatacc
acgcataaaattattcatcgtgacatcaaaccaaataatgtgttaatgactcacaaagga
gagtttaaattgtgtgattttggtgtatctcgagaattgaccaattcattggccatggcc
gatacttttgttggcacttccatgtatatgtctccggaaagaattcaaggattggactat
ggtgtaaagtctgatgtatggtctacaggattaatgttgatagaacttgccagtggtgtg
ccggtatggtctgaagataatagtaataatgacgacgatgatgaagatggagatgatggt
tgcagtgggcaaggaatattagcaacagaaagaaacgggcaaaatagtccaagcaagagc
aggaagaaaaaccaaaaagggaatggttacaactcttataatggaccagaaggtatatta
gatttattacaaagaatagttaatgaagatgcccccactttgacaaacaagatcaatcct
gtaacaaaattaccatatgacaaatatttgtgtcaattcattgatttatgtttaatcaaa
gatgattcagtaagaaaaactccttggcaattgcttgaagacaaagagcatttctttaaa
ggggtcgaggaaggtgcgtatgacaaggaacacaagagttgggcgaagaagattcgaaaa
tgtaaagtgtaa

DBGET integrated database retrieval system