KEGG   Candida dubliniensis: CD36_29180Help
Entry
CD36_29180        CDS       T01140                                 

Gene name
STE7
Definition
serine/threonine-protein kinase, putative (EC:2.7.12.2)
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
cdu  Candida dubliniensis
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CD36_29180 (STE7)
Enzymes [BR:cdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     CD36_29180 (STE7)
Protein kinases [BR:cdu01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   CD36_29180 (STE7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R:873898..875649
Genome map
AA seq 583 aa AA seqDB search
MTRTTRIDTQEATKHKDLPPVPSTSLSSNSEYLMESKSLGRKNFKKLSLDASPVKSTSNN
LRSSDMMSIKEPTSLRQKRQRPPPMLHLPTSSSSTTSTPTSNITGTSSASSVHFSQKSPG
SGVIVSQTLSRPSSAGGMGSSGYSALNINQSNRNVDPDNVVSTDMILNQISNLDLTSMNH
HRQNSHHHLPSTNRKRQTVISSISPTKSSASSSPLEPQNQSLPASSQSPIATTSALKLNN
KDLLTLKQLGSGNSGSVSKILHIPTQKTMAKKIIHIDSKSVIQTQIIRELRILHECHSPY
IIEFYGACLNNNNTIVICMEYCNCGSLDKILPLCENRQFPTFVLKKLSFAILSGLTYLYT
THKIIHRDIKPNNVLMTHKGEFKLCDFGVSRELTNSLAMADTFVGTSMYMSPERIQGLDY
GVKSDVWSTGLMLIELASGVPVWSEDNSNNDDDDEDGDDGCSGQGILATERNGQNSPSKS
RKKNQKGNGYNSYNGPEGILDLLQRIVNEDAPTLTNKINPVTKLPYDKYLCQFIDLCLIK
DDSVRKTPWQLLEDKEHFFKGVEEGAYDKEHKSWAKKIRKCKV
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgacaagaacaactcgtatagatacacaagaagctacaaagcataaggatttaccacca
gtgccttcaacatcattatcatcgaattcagaatacctaatggaatccaaaagtctagga
cgaaaaaacttcaaaaagctttctctagatgcatctccagttaaatcaaccagcaacaac
ctaaggagttctgatatgatgctgataaaggaaccaacttctttgcgacaaaagagacag
cgtcctccacctatgcttcacttacccacatcgtcttcatctaccacatctactccaaca
tccaatattacaggcacttcatcagcttcttctgtgcatttttcacagaaatcccctggg
tcaggtgttattgtaagtcaaacattaagccgaccttcaagtgctggcggtatggggtct
tctggttactcggcattgaatatcaatcagagcaataggaatgtcgatccagataacgtg
gtttcaacagatatgatattaaaccaaatatctaatttagatttaacaagtatgaaccat
catcgccaaaatagtcatcaccaccttccatcaactaatcgtaaacgtcaaactgtcatt
tcttcaatatcaccaacgaaatcatcagcatcatcatcaccattggagccacaaaatcaa
ctgttacctgcttcatcccagtctcctattgccaccactagtgcattaaagttgaacaat
aaagatttattgacattaaaacagttgggttcaggaaactctgggtcagtgctgaagatt
ttacacatacccacacaaaaaaccatggcgaagaaaatcatccatattgatctgaaaagt
gtgatacaaactcaaataatccgtgaattaagaatactacacgaatgccattctccttac
atcatcgaattttatggggcttgtttaaataacaataacactattgtcatctgtatggaa
tattgtaattgtggatcattggataaaatattgcctctttgtgagaatagacaattcccc
acttttgttttgaaaaaactatcatttgccattttatctggattaacgtatttatatacc
acgcataaaattattcatcgtgacatcaaaccaaataatgtgttaatgactcacaaagga
gagtttaaattgtgtgattttggtgtatctcgagaattgaccaattcattggccatggcc
gatacttttgttggcacttccatgtatatgtctccggaaagaattcaaggattggactat
ggtgtaaagtctgatgtatggtctacaggattaatgttgatagaacttgccagtggtgtg
ccggtatggtctgaagataatagtaataatgacgacgatgatgaagatggagatgatggt
tgcagtgggcaaggaatattagcaacagaaagaaacgggcaaaatagtccaagcaagagc
aggaagaaaaaccaaaaagggaatggttacaactcttataatggaccagaaggtatatta
gatttattacaaagaatagttaatgaagatgcccccactttgacaaacaagatcaatcct
gtaacaaaattaccatatgacaaatatttgtgtcaattcattgatttatgtttaatcaaa
gatgattcagtaagaaaaactccttggcaattgcttgaagacaaagagcatttctttaaa
ggggtcgaggaaggtgcgtatgacaaggaacacaagagttgggcgaagaagattcgaaaa
tgtaaagtgtaa

DBGET integrated database retrieval system