KEGG   Candida dubliniensis: CD36_30030Help
Entry
CD36_30030        CDS       T01140                                 

Gene name
DIT2
Definition
cytochrome p450-Dit2 homologue, putative (EC:1.14.14.-)
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
cdu  Candida dubliniensis
Pathway
Fatty acid degradation
Tryptophan metabolism
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:cdu00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:cdu00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R:complement(1001340..1002773)
Genome map
AA seq 477 aa AA seqDB search
MLQLLKYIFIGGFTYLLYLILEIVFPPFNFPRNIPTIPFYVSFLGACTSLDQEDIYKLYL
REKLEKYGAVKMYFASRWNILITKPDFLLEMFKNEDVFAKSGNHVKIPNSVLATYTGDNI
ISAHGELWKLYRDVVAQSIQFPDLKPIFKNTHKLLRFINNEMGSANQTTISVTDILQKYS
LANVCESVLGVNFNVLDDKQSLMHEKIKYVKSQIFNPIFLNFPYFDNFPIPSRLKARREV
IGFRKWYGQSLVEKYNLQLPNSAATKLVDSLIKEKLTEKQFLDNAIILMIAGHENPLLLM
LSLLYVVSKYPQVQELIRNETEPTKPYFHSVIYETLRMYPPLGLIINRCTTRITKLGNIV
IPKNVYCGYNNFGTGRDRNVWGSDADTFKPERWGVEIDEINKKFTLAKRSAELPAFHGRK
RACLGEKYALFEVKQFLLAILGDYKVSLDPTWKEQLTAAGPISPLQLKIKFEKLTVS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaactattgaaatatatctttattggaggattcacatatttgctttatttgatt
ttggagatagttttcccaccattcaattttcctagaaatatcccaacaataccattttat
gtgtcgtttttaggtgcttgcactagtttagatcaagaggatatctacaaattatatcta
cgggaaaaattggaaaaatatggggctgttaaaatgtactttgcatcaagatggaatatt
ttaatcaccaaaccagatttcttacttgaaatgtttaagaatgaagatgtatttgccaaa
agtggcaatcatgtcaagattccaaactcagttttggcaacttatactggggacaatatc
attagtgctcatggagaattgtggaaactataccgagatgttgttgcccaaagtatccaa
tttcctgatttgaaaccgattttcaagaatacacacaagttgttacgatttatcaataat
gaaatgggatcagcaaatcaaaccactatttcagtcacagatatattacagaaatattcc
ttggctaatgtatgtgaatctgtccttggcgttaattttaatgtactcgatgacaagcaa
tcacttatgcatgagaaaatcaagtatgttaagctgcaaatatttaatcccattttcttg
aattttccctattttgacaatttccctattccaagtcgacttaaggcaagaagagaagtg
attgggttccgcaaatggtatggtcaaagtcttgtagaaaagtataatttacaattgcca
aactcagcagctacaaagttagtggattctttgatcaaagaaaaattgacagaaaagcaa
tttttggataatgctataattttaatgatagctggtcatgaaaatccattattattaatg
ttgtcgttgttatacgttgtttccaaatacccacaagtccaagaattaatacgtaatgag
acagaaccaacaaaaccttactttcattcagtcatttatgagactctaagaatgtatcca
ccattgggattaatcataaatagatgtacaactagaatcaccaaattaggcaatattgtt
atccctaagaatgtttattgcggttacaataattttggtacgggaagggatagaaatgta
tgggggtcagatgctgatactttcaaaccagaacgatggggagtagaaattgatgaaatt
aacaagaaatttactttagctaaaagatcagctgagttgcctgcatttcatggcaggaaa
agagcatgcttgggtgagaagtatgcattgtttgaagttaaacaattcttattggcaatt
ctaggtgattataaagtgtctctagacccaacttggaaagaacaattgacagctgctggg
ccaattagccccttgcaattgaaaataaaatttgaaaaacttacagtttcctaa

DBGET integrated database retrieval system