KEGG   Candida dubliniensis: CD36_30030Help
Entry
CD36_30030        CDS       T01140                                 

Gene name
DIT2
Definition
cytochrome p450-Dit2 homologue, putative (EC:1.14.14.-)
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
cdu  Candida dubliniensis
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    CD36_30030 (DIT2)
  Amino acid metabolism
   00380 Tryptophan metabolism
    CD36_30030 (DIT2)
Enzymes [BR:cdu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     CD36_30030 (DIT2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R:complement(1001340..1002773)
Genome map
AA seq 477 aa AA seqDB search
MLQLLKYIFIGGFTYLLYLILEIVFPPFNFPRNIPTIPFYVSFLGACTSLDQEDIYKLYL
REKLEKYGAVKMYFASRWNILITKPDFLLEMFKNEDVFAKSGNHVKIPNSVLATYTGDNI
ISAHGELWKLYRDVVAQSIQFPDLKPIFKNTHKLLRFINNEMGSANQTTISVTDILQKYS
LANVCESVLGVNFNVLDDKQSLMHEKIKYVKSQIFNPIFLNFPYFDNFPIPSRLKARREV
IGFRKWYGQSLVEKYNLQLPNSAATKLVDSLIKEKLTEKQFLDNAIILMIAGHENPLLLM
LSLLYVVSKYPQVQELIRNETEPTKPYFHSVIYETLRMYPPLGLIINRCTTRITKLGNIV
IPKNVYCGYNNFGTGRDRNVWGSDADTFKPERWGVEIDEINKKFTLAKRSAELPAFHGRK
RACLGEKYALFEVKQFLLAILGDYKVSLDPTWKEQLTAAGPISPLQLKIKFEKLTVS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaactattgaaatatatctttattggaggattcacatatttgctttatttgatt
ttggagatagttttcccaccattcaattttcctagaaatatcccaacaataccattttat
gtgtcgtttttaggtgcttgcactagtttagatcaagaggatatctacaaattatatcta
cgggaaaaattggaaaaatatggggctgttaaaatgtactttgcatcaagatggaatatt
ttaatcaccaaaccagatttcttacttgaaatgtttaagaatgaagatgtatttgccaaa
agtggcaatcatgtcaagattccaaactcagttttggcaacttatactggggacaatatc
attagtgctcatggagaattgtggaaactataccgagatgttgttgcccaaagtatccaa
tttcctgatttgaaaccgattttcaagaatacacacaagttgttacgatttatcaataat
gaaatgggatcagcaaatcaaaccactatttcagtcacagatatattacagaaatattcc
ttggctaatgtatgtgaatctgtccttggcgttaattttaatgtactcgatgacaagcaa
tcacttatgcatgagaaaatcaagtatgttaagctgcaaatatttaatcccattttcttg
aattttccctattttgacaatttccctattccaagtcgacttaaggcaagaagagaagtg
attgggttccgcaaatggtatggtcaaagtcttgtagaaaagtataatttacaattgcca
aactcagcagctacaaagttagtggattctttgatcaaagaaaaattgacagaaaagcaa
tttttggataatgctataattttaatgatagctggtcatgaaaatccattattattaatg
ttgtcgttgttatacgttgtttccaaatacccacaagtccaagaattaatacgtaatgag
acagaaccaacaaaaccttactttcattcagtcatttatgagactctaagaatgtatcca
ccattgggattaatcataaatagatgtacaactagaatcaccaaattaggcaatattgtt
atccctaagaatgtttattgcggttacaataattttggtacgggaagggatagaaatgta
tgggggtcagatgctgatactttcaaaccagaacgatggggagtagaaattgatgaaatt
aacaagaaatttactttagctaaaagatcagctgagttgcctgcatttcatggcaggaaa
agagcatgcttgggtgagaagtatgcattgtttgaagttaaacaattcttattggcaatt
ctaggtgattataaagtgtctctagacccaacttggaaagaacaattgacagctgctggg
ccaattagccccttgcaattgaaaataaaatttgaaaaacttacagtttcctaa

DBGET integrated database retrieval system